KEGG   Mycoplasma genitalium G37: MG_091Help
Entry
MG_091            CDS       T00002                                 

Definition
(GenBank) single-strand binding protein family
  KO
K03111  single-strand DNA-binding protein
Organism
mge  Mycoplasma genitalium G37
Pathway
mge03030  DNA replication
mge03430  Mismatch repair
mge03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mge00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MG_091
   03430 Mismatch repair
    MG_091
   03440 Homologous recombination
    MG_091
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mge03032]
    MG_091
   03400 DNA repair and recombination proteins [BR:mge03400]
    MG_091
   03029 Mitochondrial biogenesis [BR:mge03029]
    MG_091
DNA replication proteins [BR:mge03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    MG_091
DNA repair and recombination proteins [BR:mge03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     MG_091
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    MG_091
Mitochondrial biogenesis [BR:mge03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    MG_091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB IP_trans
Motif
Other DBs
NCBI-ProteinID: AAC71309
UniProt: P47337
Position
117553..118035
Genome map
AA seq 160 aa AA seqDB search
MNRVFLFGKLSFTPNRLQTKNGTLGATFSMECLDSSGFNNAKSFIRVTAWGKVASFIVAQ
NPGVMLFVEGRLTTYKITNSENKNTYALQVTADKIFHPDEKTTNEEPIKSTVVDSPFMNP
KASVTEAEFEQAFPHQDETDFNNITPIFENDVQLEEESDD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgggtcttcttgtttggtaaactcagttttactcccaaccgtttacagacaaaa
aatggtacgttaggagctactttttccatggaatgtcttgattccagtggttttaataat
gccaaatcattcattagagtaactgcttgaggtaaagttgctagttttattgttgctcaa
aatcctggggtgatgctttttgtagaaggaagattaactacatataaaattactaacagt
gaaaataaaaacacctatgctttacaagtaactgctgataagatctttcatcctgatgaa
aaaactaccaatgaagaacctattaaatcaactgtagttgattcaccctttatgaatccc
aaagcaagtgttacagaagctgagtttgaacaagcattcccccatcaagatgaaactgat
tttaacaacattacccctatatttgaaaatgatgtccaactagaggaggaaagtgatgat
taa

DBGET integrated database retrieval system