KEGG   Mycoplasma genitalium G37: MG_102Help
Entry
MG_102            CDS       T00002                                 

Gene name
trxB
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:mge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MG_102 (trxB)
Enzymes [BR:mge01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     MG_102 (trxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thi4 HI0933_like FAD_binding_2 FAD_oxidored NAD_binding_8 Lycopene_cycl GIDA DAO
Motif
Other DBs
NCBI-ProteinID: AAC71320
UniProt: P47348
Position
129348..130295
Genome map
AA seq 315 aa AA seqDB search
MLKVNADFLTKDQVIYDLVIVGAGPAGIASAIYGKRANLNLAIIEGNTPGGKIVKTNIVE
NYPGFKTITGPELGLEMYNHLLAFEPVVFYNNLIKIDHLNDTFILYLDNKTTVFSKTVIY
ATGMEERKLGIEKEDYFYGKGISYCAICDAALYKGKTVGVVGGGNSAIQEAIYLSSIAKT
VHLIHRREVFRSDALLVEKLKKISNVVFHLNATVKQLIGQEKLQTVKLASTVDKSESEIA
IDCLFPYIGFESNNKPVLDLKLNLDQNGFILGDENMQTNIKGFYVAGDCRSKSFRQIATA
ISDGVTAVLKVRDDI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagtgaatgctgattttttaactaaagatcaagttatctatgatttagtgata
gtaggtgctggccctgctgggattgctagtgccatttatggtaaacgtgctaacttaaat
ttagcaattattgaaggaaacactccaggagggaagatagtaaaaactaacattgtggaa
aactatcctggttttaaaaccataactggtcctgaattaggtcttgagatgtacaaccac
ttgttagcatttgaaccagttgttttttataacaacttaatcaaaattgatcatcttaac
gatacattcatcttgtatttagataacaaaacgacagtttttagcaaaactgttatctat
gcaacagggatggaagagagaaaacttggcattgaaaaggaagattatttttatggtaaa
gggattagttattgtgctatttgtgatgcggctctttacaaaggtaaaacagttggtgtt
gtaggaggaggtaattctgcaatacaggaagcaatttatctttcaagtattgctaaaaca
gttcaccttattcacagacgtgaagtgtttagaagtgatgcattactagttgaaaaatta
aaaaaaattagtaatgtagtttttcatttaaatgctactgtaaaacagttaataggtcaa
gaaaagctccaaactgttaaattggcaagcacagttgataaatcagaaagtgaaattgca
attgattgtctctttccttacataggctttgaaagtaataacaagccagttttagatctt
aagcttaatttagatcaaaatggttttattttaggagatgaaaatatgcaaactaacatt
aagggtttttatgttgctggggattgtagaagtaaatcattccggcaaattgccactgca
attagtgatggggtaacagctgttttaaaggttagggatgacatttag

DBGET integrated database retrieval system