KEGG   Mycoplasma genitalium G37: MG_104Help
Entry
MG_104            CDS       T00002                                 

Definition
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.-.-]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MG_104
Enzymes [BR:mge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     MG_104
Messenger RNA biogenesis [BR:mge03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     MG_104
Transfer RNA biogenesis [BR:mge03016]
 Prokaryotic Type
  tRNA degradation factors
   MG_104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB S1 H-kinase_dim DUF4897 MOLO1
Motif
Other DBs
NCBI-ProteinID: AAC71322
UniProt: P47350
Position
131385..133562
Genome map
AA seq 725 aa AA seqDB search
MKVLTELQKQIFTIVKKENGKPIPPGIVVRMMENSPNFPGKHLIYRAIDDLLDWAILRKA
GGVTNQLLVNYEPAEPLLDKKLQGILTLGNKNSGFIRSLDDDKTVYYVHYSNLTGALDGD
LVEFCKLDKPQFGDKFDAAVITILKRARILYAGNFLVDQNEFALEYKIVADNPRFYLTMI
VNPDSIPNNLASNTKIAFQIDEYDPDNNLCKVSVQQVLGNNDDPLINIKAIMLDNSIVFE
TNDVVEQHANKLSFDTEEQHKAYRQDLTDLAFVTVDPTTSKDLDDAIYVKTIPTGFVLYV
AIADVAHYVNRNSEIDIEAKHKTSSIYLPGHYVVPMLPEQLSNQLCSLNPAQKRYVVVCE
ISFDNQGRIKTNKLYPATIISKNRFSYDQVNKWLNNKSELNCDETVINSLKAAFTLSDLI
QAQRQKRGTIDLSHKETEIVVDEHYFPIKINFLVHDKAETMIENLMVVANETVAWVLTNN
KIALPYRVHPRPSKKKLQSLIETVGELNITKPQFNLDTVTSSQIASWLNENKDNPSYEIF
VILLLRTLGKAFYSVNPLMHFSIGSNHYTHFTSPIRRYIDLTIHRLLWMHLFTPDQFTDN
ERDQLKQELEKIADTVNDTEIKIINCERNANDYLTTLLLSKQIGKTFSGFISAITSFGIF
MRMDENNFDGLIKITTIPDDFFIFEKEKMVLKGRKTNKVYKIGDRLEAKLSEIDFIQKRA
ILTLI
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttaactgaactccaaaagcagatatttaccattgtcaaaaaggaaaatggt
aaacctattccccctggaatagtggtaagaatgatggaaaatagtcctaattttccaggt
aaacatctcatctatcgggccattgatgatctgcttgattgagccatcttaaggaaagct
ggtggggttacaaaccagctattagttaactatgaacctgctgagcctttacttgataaa
aaactacaagggattttaaccttaggaaataagaatagtggttttatccgctctttggat
gatgataaaactgtgtattatgtccattactctaatttaactggagctttagatggggat
cttgtggagttttgtaaattagataaaccccaatttggtgataagtttgatgctgcagtt
attactattctaaaaagagcaagaatcttgtatgcaggtaattttttagtagatcaaaat
gagtttgccttggaatacaaaattgttgctgataaccctagattttatttaactatgatt
gtaaatcctgattctatcccaaataacttagcatctaacaccaagatagcttttcaaatt
gatgagtatgatcctgataacaacttatgtaaggtttctgtacaacaagttttgggtaac
aatgatgatccgctaattaatataaaagcaatcatgttggacaattccattgtctttgaa
actaacgatgtagttgaacagcatgctaacaagttaagttttgatactgaagaacaacat
aaagcttaccgtcaggatttaactgatttagcttttgtgactgttgatcctacaacatca
aaagaccttgatgatgctatttatgtcaaaacaataccaacaggttttgtgctttatgta
gctattgctgatgttgcacactatgttaatagaaatagtgaaatagacattgaagcaaaa
cacaaaacaagctcaatctatctacctggtcattatgttgtgcccatgctacctgagcaa
ttgtcaaatcagctctgttctttaaatccagcacaaaaacgttatgttgttgtttgtgag
attagttttgataatcagggaaggattaaaacaaacaagctttacccagcaacaattatt
tccaaaaatcgttttagctatgatcaggttaacaagtggttaaataataaatcagaatta
aactgtgatgaaacagttatcaacagcttaaaagcagcttttacactaagtgatctaatt
caagcgcaacgtcaaaaacgcggtacaattgatctttcacacaaagaaactgagatagtt
gttgatgaacattattttcccattaagataaattttttggttcacgataaagctgaaacc
atgattgaaaatctcatggtagtggccaatgagacagttgcttgggtgttaactaacaac
aaaattgctttaccatacagagttcacccaagaccaagcaaaaagaagttacaaagtttg
attgaaacagttggtgagttgaacataactaaaccccaatttaacttagatactgtcact
tcaagccaaatagctagctgattaaatgaaaacaaagataatcctagttatgagatcttt
gtaatcctcttattaagaacactaggcaaagctttttatagtgttaatcccctgatgcac
ttcagcattggttctaaccactatacccactttacttcaccgattagaaggtatatagat
ctaaccattcacaggttgttgtgaatgcatctttttactcccgatcaattcactgataat
gaaagagatcaactcaaacaagagttggaaaaaattgctgatacagttaatgatacagag
attaaaattatcaattgtgaaagaaatgccaatgattatctaacaacgctgttattatca
aaacaaattggcaaaaccttcagcggatttatttcagcaattactagctttggaattttt
atgagaatggatgaaaataactttgatgggttaatcaaaattacaactatccctgatgat
ttctttatttttgaaaaggaaaaaatggtattgaaaggaagaaaaactaataaggtttat
aaaattggcgatcgtttggaagctaaactaagtgagattgatttcatccaaaaacgtgct
attttaacactcatataa

DBGET integrated database retrieval system