KEGG   Mycoplasma genitalium G37: MG_107Help
Entry
MG_107            CDS       T00002                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge00230  Purine metabolism
mge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MG_107 (gmk)
Enzymes [BR:mge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MG_107 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin dNK AAA_18 ABC_tran AAA_16 AAA_22 AAA_33 RsgA_GTPase NTPase_1 AAA_29 AAA_14 ATPase_2 AAA_21 MMR_HSR1 Rad17 AAA RNA_helicase AAA_28 AAA_17 AAA_23 Cytidylate_kin AAA_30 AAA_5 Thymidylate_kin DUF5089 Roc DUF815 KAP_NTPase ATP_bind_1 NACHT AAA_24 IstB_IS21 T2SSE AAA_19 cobW NB-ARC ArgK TsaE CPT SMC_N MobB DUF87
Motif
Other DBs
NCBI-ProteinID: AAC71325
UniProt: P47353
Position
134769..135338
Genome map
AA seq 189 aa AA seqDB search
MNNQGRIFVITGPSGVGKSTLVKALLDHFKEQLFYSISATTRKKRISEKEGIDYFFKDKD
EFENLIKQDAFIEWACYNNHYYGTLKSQAEQAIKSGINLMLEIEYQGALQVKSKYPHNVV
LIFIKPPSMQELLKRLKKRNDEDETTIKKRLEQAKIEFQQIDNFKYVVTNKEFDKTLNEL
KSILLSEFI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatcaggggagaatttttgtcattactggtcctagcggtgttggcaaaagcacc
cttgttaaagccttattagatcatttcaaagaacaactgttctacagtatctctgcaact
acaagaaaaaagcgcattagtgaaaaagagggaattgattatttttttaaagataaagat
gagtttgaaaacttaataaaacaagatgctttcattgaatgggcttgctataataaccat
tattatggaacgctcaagtctcaagctgaacaagcaattaaaagcggaattaatttaatg
cttgaaattgagtatcaaggtgctttacaggttaaaagtaaatatcctcataacgttgtt
ttaattttcattaaaccaccttcaatgcaagagttgttaaaacgtttaaaaaagcgtaat
gatgaagatgaaaccacaattaaaaaacgtttagaacaagctaagatagagtttcaacag
attgataattttaagtatgttgtcactaacaaagagtttgataaaacccttaatgagttg
aaatcaatcttactatctgagtttatttaa

DBGET integrated database retrieval system