KEGG   Mycoplasma genitalium G37: MG_112Help
Entry
MG_112            CDS       T00002                                 

Gene name
rpe
Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge00030  Pentose phosphate pathway
mge00040  Pentose and glucuronate interconversions
mge01100  Metabolic pathways
mge01110  Biosynthesis of secondary metabolites
mge01120  Microbial metabolism in diverse environments
mge01130  Biosynthesis of antibiotics
mge01200  Carbon metabolism
mge01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MG_112 (rpe)
   00040 Pentose and glucuronate interconversions
    MG_112 (rpe)
Enzymes [BR:mge01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     MG_112 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim DUF3557
Motif
Other DBs
NCBI-ProteinID: AAC71330
UniProt: P47358
Position
139397..140026
Genome map
AA seq 209 aa AA seqDB search
MATKVVFSLLPLLNRFDKSLLESYFQDGLRLIHYDVMDQFVHNTAFKGEYLDELKTIGFD
VNVHLMVEQIIPQINFYLSQPNVKRISFHVEPFSFAKIKELIQLVKENGKEVGLAFKFTT
NLQLYQPFFTTIDFITLMSVPPGKGGQAFNEAVFTNLKIANHYNLKIEIDGGIKVNNIDQ
IKAFVDFIVMGSGFIKLEQWQRQKLLQTI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtggccactaaggttgttttttcactcttaccacttttaaataggtttgacaagtcactt
ttagaaagttactttcaagatggattgaggttaatccattatgatgtgatggaccaattt
gttcataatactgcttttaaaggtgaatatttggatgaattgaaaacaataggttttgat
gttaatgtccatttaatggtggaacagatcatccctcaaataaatttttatctttcacaa
cctaatgtgaaaaggatttcgtttcatgttgaaccatttagttttgcaaagattaaagaa
ctaatccaactagttaaagaaaatggtaaagaagttggtcttgcttttaaatttacaacc
aatttacaactataccaaccattttttacaaccatcgactttatcactttaatgagtgtt
cctcctggtaaaggtggtcaagcttttaacgaagctgtttttacaaatttaaagattgct
aaccattacaacttgaaaattgagattgatggtgggattaaagttaataacattgatcaa
attaaagcctttgttgatttcattgtaatgggaagtggctttataaaattagagcagtgg
caacgtcaaaaattgttgcaaacaatctaa

DBGET integrated database retrieval system