KEGG   Mycoplasma genitalium G37: MG_114Help
Entry
MG_114            CDS       T00002                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge00564  Glycerophospholipid metabolism
mge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MG_114
Enzymes [BR:mge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     MG_114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: AAC71332
UniProt: P47360
Position
141346..142056
Genome map
AA seq 236 aa AA seqDB search
MDWKTSEMLFPFPVYMAPLTSKFAAYKKKIANWLTVYRIFIALPTIIFIALDNQLGVLAN
FSVGAISISLQISLLIGGFLFLTAVISDYLDGYLARKWLAVSNFGKLWDPIADKVIINGV
LIALAINGYFHFSLLIVFIVRDLVLDGMRIYAYEKKVVIAANWLGKWKTIMQMVGIVFSC
FVWSFKQSEIASLNSGLFFWLLTQLPYYLAAVFSIWSFIVYNIQIYQQLKAYNSKL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtggattggaaaacatcagagatgctattccctttccccgtgtacatggcaccattaact
tctaaattcgctgcttataaaaaaaagattgcaaactggttaacagtttacagaattttt
attgctttacctactattatttttattgctttagataatcaactaggagttttagctaac
ttttctgttggtgcaattagcattagtttacagatcagtttattgattggaggatttttg
tttttaactgcagttatatcagattatttagatggatatttagcaagaaaatggctagca
gtttctaactttggtaaattatgagaccccattgctgataaagtgattatcaatggtgtt
cttattgcactagcgattaatggatattttcactttagcttattaattgtttttatagtc
cgtgatcttgtgttggatggaatgcggatttatgcttatgagaaaaaggtggttattgct
gctaactgacttggaaaatgaaaaactatcatgcagatggttggtattgtttttagttgt
tttgtttggagttttaaacaaagtgaaatagcttctttgaatagtggactgttcttttga
ttactaactcaactgccatattatttagcagcagttttttcaatttggtctttcattgtt
tataacatccaaatatatcagcaactaaaggcttataactccaagttataa

DBGET integrated database retrieval system