KEGG   Mycoplasma genitalium G37: MG_120Help
Entry
MG_120            CDS       T00002                                 

Definition
(GenBank) ABC transporter, permease protein
  KO
K02057  simple sugar transport system permease protein
Organism
mge  Mycoplasma genitalium G37
Brite
Transporters [BR:mge02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    MG_120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: AAC71338
UniProt: P47366
Position
146674..148236
Genome map
AA seq 520 aa AA seqDB search
MTMWQFKSYFKHHLVFWKDRFLHSSEKQMQRRSILSSVVLIILSFLISFLLIISIPGGRG
ASFFALFTKLFLDNTNTENFLRQIAIYILAGLAFSFCMSVGIFNIGISGQMMAGAIFGFL
MILKVFPSSFRPGFGGQIITVLLMVIGSVSVAVVVATLKIFFKVNEVVSAIMLNWIVVLI
SAYLVETYIKDNSGGTAQFFSLPLPDEFALYNFSPLTKKFGWLASLIIAFISVIIVAVVL
KYTVFGHKLKSIGSSVFGSQAMGFNVRKYQFLSFIISGILSGLLATVVYTASTEKVLTFN
NVGDSAISAVPATGFDGIAIGLIALNNPFRIVIVSVLIAFVNIGARPANLNPNTASLVLG
IMMYFAALYNLMVYFKPWRYLVKLNIGKINLTTYETYENKLAANLEWLSFQRFLSKQKKK
NDKTKFNWFDTSLFEQYAKNKQEIVQEYHHNCATNLIAWWLNAIQSGNIKPSTTFKLEFV
NFKHQQKFVLNWFKNESESLRDFQSQFERINKLVEREFVK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgtggcaatttaaaagttactttaaacaccacctggtgttttgaaaagaccga
tttttacatagctctgagaaacaaatgcaaagaagaagtatcctctcttcagtggttttg
ataatcctctcttttcttatatcgtttttactgattatttcaattcctggaggtagaggt
gcgagcttctttgcactgtttactaagttatttttagataacactaatactgaaaatttc
ttaagacagattgctatttatatcctagctggattagcatttagtttctgtatgagtgtt
ggtattttcaacattggtatctcagggcagatgatggctggagccatctttgggttttta
atgattctcaaggtgtttccaagttcatttcgacctggttttggaggtcagattattact
gtattattgatggtaataggtagtgttagtgtggcagttgttgttgcaactttaaagatt
tttttcaaggttaatgaagttgtaagtgcaattatgttgaactgaattgtagtgcttatt
agtgcttatttagtagagacttacattaaagataatagtgggggtacagcccaattcttt
tccttaccactccctgatgaatttgctttatataacttctctcctttaacaaaaaagttt
ggttgattagcttcacttattattgctttcattagtgttattattgtggcagtagtatta
aaatacacagtttttggacacaaattaaagtcaattggcagtagtgtatttggttctcag
gcaatgggttttaatgttagaaaataccagttcttatcgtttattatctcaggaatttta
tcaggactattagcaacggttgtttacactgcatcaactgaaaaagtattgacatttaac
aatgttggggatagtgctatttcagcagtaccagctactggttttgatgggattgcgatt
ggtttaattgctttaaataacccctttaggattgttattgtttctgttcttattgctttt
gttaacattggggcaagacctgctaatttaaaccctaatactgctagtttagttttagga
atcatgatgtattttgctgcactttataacctaatggtttactttaaaccatgaagatac
ctagtgaagctgaacattggaaagataaatctcaccacatatgaaacatatgaaaacaaa
ctagctgctaacctagagtgactaagtttccaacgcttcttgtcaaaacagaaaaaaaag
aatgacaaaactaaatttaattggtttgatactagtttatttgaacaatatgcaaaaaac
aaacaagaaattgttcaagaataccatcacaattgtgcaactaatttaattgcttggtga
ttgaatgcaatccaaagtggcaatattaaaccttcaactacttttaagttggaatttgtt
aattttaaacaccaacagaagtttgtattaaattggtttaaaaatgaaagtgaatcactg
cgtgatttccaatcacagtttgagagaatcaataagttagtggaaagggagtttgttaag
taa

DBGET integrated database retrieval system