KEGG   Mycoplasma genitalium G37: MG_127Help
Entry
MG_127            CDS       T00002                                 

Definition
(GenBank) Spx subfamily protein
  KO
K16509  regulatory protein spx
Organism
mge  Mycoplasma genitalium G37
Brite
KEGG Orthology (KO) [BR:mge00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    MG_127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsC SR1P Sec3_C_2 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AAC71345
UniProt: P47373
Position
154999..155436
Genome map
AA seq 145 aa AA seqDB search
MKKAGKKNSDAGKTFILISSSCSSCQKAIEFFDQNKISYVVENFYKKPISDKRFKDILSL
SEDGTESLFSKRADQIKATNSVSVEELSISELIKLVRERPSLLRRPIIIQYNSSGIPKRM
RIGYNSSEIKVFERKLIEPKPIIQQ
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgggtaaaaaaaatagtgatgcaggtaagacttttatcttaatctcatca
tcctgttcatcctgtcagaaagccattgagttttttgatcaaaacaaaattagctatgtt
gttgagaatttttataaaaaaccaattagtgataagcgttttaaagatattttaagtctt
agtgaggatggtactgaaagtttgttttccaaacgtgctgatcagattaaagcaactaac
agtgttagtgttgaagagttgagtatcagtgaattaattaagctagttagagaacgtcct
tctttactaagaaggcctattatcatccaatataattcttcaggaattcctaaaaggatg
cgaattggttataactcatctgaaattaaggtctttgagcgtaaactaatagaaccaaag
cctataatacaacaataa

DBGET integrated database retrieval system