KEGG   Mycoplasma genitalium G37: MG_130Help
Entry
MG_130            CDS       T00002                                 

Definition
(GenBank) uncharacterized domain HDIG
  KO
K18682  ribonucrease Y [EC:3.1.-.-]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MG_130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:mge03019]
    MG_130
Enzymes [BR:mge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     MG_130
Messenger RNA biogenesis [BR:mge03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     MG_130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD HDOD STT3 DUF86 7TM_GPCR_Srw DUF1843
Motif
Other DBs
NCBI-ProteinID: AAC71348
UniProt: P47376
Position
156566..158020
Genome map
AA seq 484 aa AA seqDB search
MNNNITNSIAQLFFNTSFFAFLFLIIIAFNLCLFAYLYFQYRIYKKNPKKANNFKANEYE
KIKLLKNQNFTESNKLIATTNELNELTSQLDNILVRIINKPLAKLVNDFLDEQIKQIVKL
DKNSSDFHSESDNLPFYTKLFNDFHFGVDKLININIKNPLYNWVYSPSFLISESDFRKLN
GISGINKKLLVEKLRIEDIVFTDLNKKYEVNVLTESPIKAQKTVLTVRNILMNDYVDNER
IESYVQQANFFFTEHCKKIGKEILESLNIFISSSSLHRHFGFLAFRYSFGQNVLSHSLET
AFLTAHLAALIELDSELSLKCGLLHDIGKSNDDNGKESHTITGAKLAEQFQLPDDIKYTI
ANHHNKHIDNTYCRLTQIADKLSAARIGARSDSSLLFKQLKDELKKIVDKTINNFHTTIL
LGQSGRRLMIWLETKNQNQLLSNEQIIEMVEKIKAEIAKNPITNHFPIKVVIRYNFEHSF
NTKS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataacattactaacagtattgcccaattgtttttcaacacttctttctttgct
tttctgtttttaatcattattgcgtttaatttatgcttgtttgcctatctttattttcag
taccgaatttataagaaaaaccctaaaaaagctaacaactttaaagcgaatgaatatgaa
aaaattaagctattaaaaaaccaaaatttcactgaaagtaataaattaattgcaacaact
aatgagttaaatgaacttactagtcagctagataatatcttggttaggattatcaacaaa
ccactagcaaagttagttaatgattttttagatgaacagattaaacagatagttaagcta
gataaaaacagttctgattttcactcagaaagtgataacctccctttttataccaaactc
tttaatgattttcactttggtgttgataaattaataaacattaacataaaaaaccctctt
tataactgggtttatagccccagttttttaattagtgaaagtgattttcgcaagcttaat
ggtattagtggtatcaataaaaagcttttggttgaaaaacttagaattgaagacattgtg
tttacagatctaaacaaaaagtatgaagttaatgtcttgacagaaagtcctattaaagca
caaaaaacagtgttaactgtgcgcaatatcctgatgaacgattatgttgataatgaaagg
attgaatcatatgtccaacaagctaacttcttttttactgagcactgtaaaaagatcggt
aaagagatcttagaatcacttaatatttttatctcaagtagttcactacaccgtcatttt
ggctttttagcatttcgctattcatttggacaaaatgtcttatcccatagccttgaaact
gcatttttaactgcccacttagcagctttaatagaacttgatagtgaactgagtttaaag
tgtggattgctccatgatattggtaaatctaatgatgataatggtaaagagagccatacg
attacaggcgctaaactcgctgagcaatttcaactacctgatgacattaaatacacaatt
gctaaccaccacaataaacatattgacaatacctattgtcgtttaacacaaattgctgat
aaactatctgctgctagaattggtgctagaagtgatagttcgcttctttttaaacaacta
aaagatgagttgaaaaagattgttgataaaactattaataattttcatacaacgatctta
ctaggtcaaagtggtagaaggttaatgatttgacttgaaactaaaaaccaaaatcaactg
ttaagtaatgagcaaattattgaaatggttgaaaagattaaagctgaaattgctaagaat
ccaattacaaatcacttccctattaaagttgtaattagatataactttgaacacagtttt
aacaccaaaagctaa

DBGET integrated database retrieval system