KEGG   Mycoplasma genitalium G37: MG_136Help
Entry
MG_136            CDS       T00002                                 

Gene name
lysS
Definition
(GenBank) lysyl-tRNA synthetase
  KO
K04567  lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge00970  Aminoacyl-tRNA biosynthesis
Module
mge_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mge00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MG_136 (lysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mge01007]
    MG_136 (lysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mge03016]
    MG_136 (lysS)
Enzymes [BR:mge01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     MG_136 (lysS)
Amino acid related enzymes [BR:mge01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   MG_136 (lysS)
Transfer RNA biogenesis [BR:mge03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MG_136 (lysS)
 Prokaryotic Type
   Other AARSs
    MG_136 (lysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: AAC71353
UniProt: P47382
Position
160963..162435
Genome map
AA seq 490 aa AA seqDB search
MSDRLNDQAQHRLQKLLRLKQTNNDPYLVTKTSLTHSSKSFQVEFEKCSEEELKKKATVS
LAGRIIAIRQTFLIIQDFDGQVQLYINKKIHPKLFDYFNEFVDIGDQIVVSGKPMLTKTK
VLTLAVEEMKIIAKCLLVPPEKWHGLTDIETRARKRFLDLTYNLAMRDVFLKRTKIIKSI
RSFLDQNGFIEVETPTLQAVLGGANAKPFKTHYNALKADFYLRIANEIALKKLIIGGFNK
VYEMGKMFRNEGVDTTHNPEFTSIEIYQAYADFEVMLVLVEKLIQSLCESLNQFSFNWNN
KTINLKTPFHKITMVELIKKVTGIDFNSVKDDQSAILLAEKHHVKLAKHQQNKQHIINLF
FEQFCEQTLIEPTFVTHYPKAVSPLAKQDPSNPEFTQRFELFINGKEIANAYSELNDPLE
QRKRFEQQLEEKQLGNDETSELDESFLEALSFGMVNTAGLGIGIDRLVMLLCECNSIRDV
VFFPQLREHK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcgtttaaatgatcaagcccaacatcgcttgcagaaacttttaaggttaaaa
caaactaataatgacccttatttagtaacaaaaactagtctaacccattcttcaaaaagc
tttcaagttgaatttgaaaaatgttcagaagaagagttgaagaaaaaagcaactgtctca
ctagctggaaggatcattgctattagacaaacctttttaattattcaagattttgatggt
caagtccaactttacatcaataaaaaaatccatcctaagttatttgattactttaatgaa
tttgttgatattggtgatcaaattgttgttagtggtaagccaatgttaactaaaacaaag
gtattaactttagctgttgaagagatgaaaatcattgctaagtgtttattggttccacct
gaaaagtgacatggacttactgatattgaaacccgcgctcgcaagcgctttcttgatctt
acctataacttagcaatgcgtgatgtttttctgaaacgcactaagattattaaatcaatc
cgtagctttcttgatcaaaatggttttattgaagttgaaacccccactttacaagctgtt
ttaggaggagctaatgctaaaccctttaaaacccattacaatgctttaaaagcggatttt
tatctcagaattgctaatgaaatagcattaaaaaaactcattattggtggatttaacaag
gtttatgaaatgggtaaaatgttccgtaatgaaggggttgatactacccacaatcctgag
tttaccagtattgaaatatatcaagcttatgcagattttgaagtcatgcttgtgcttgtt
gaaaagctgattcaatcactttgtgaaagcttaaaccaatttagctttaactgaaataac
aaaacgattaatctaaaaacaccatttcataagataacaatggttgaacttattaagaaa
gttacagggatcgattttaattcagtaaaagatgatcaatctgccattttattagcagaa
aaacatcatgttaaactagcaaaacaccaacaaaataagcaacacatcattaatttgttt
tttgaacagttttgtgaacaaacattaattgaacctacctttgtaacccattatccaaaa
gcagtttctcctttagcaaaacaagatccttcaaatcctgaattcacccaacgatttgaa
ctttttattaatggtaaagagattgctaatgcttacagtgagctaaacgatcctttagaa
caaagaaaaaggtttgaacaacaacttgaagaaaaacagcttggtaatgatgagacaagt
gaacttgatgaatcgtttttagaagcattaagttttgggatggtaaacactgctgggctt
gggataggtattgatcgtttggtaatgttgttatgtgaatgtaattctatccgtgatgtt
gttttcttcccccagttgcgtgaacataaatag

DBGET integrated database retrieval system