KEGG   Mycoplasma genitalium G37: MG_215Help
Entry
MG_215            CDS       T00002                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge00010  Glycolysis / Gluconeogenesis
mge00030  Pentose phosphate pathway
mge00051  Fructose and mannose metabolism
mge00052  Galactose metabolism
mge00680  Methane metabolism
mge01100  Metabolic pathways
mge01110  Biosynthesis of secondary metabolites
mge01120  Microbial metabolism in diverse environments
mge01130  Biosynthesis of antibiotics
mge01200  Carbon metabolism
mge01230  Biosynthesis of amino acids
mge03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MG_215 (pfk)
   00030 Pentose phosphate pathway
    MG_215 (pfk)
   00051 Fructose and mannose metabolism
    MG_215 (pfk)
   00052 Galactose metabolism
    MG_215 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MG_215 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MG_215 (pfk)
Enzymes [BR:mge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MG_215 (pfk)
Protein phosphatases and associated proteins [BR:mge01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MG_215 (pfk)
Messenger RNA biogenesis [BR:mge03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MG_215 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AAC71434
UniProt: P47457
Position
254621..255592
Genome map
AA seq 323 aa AA seqDB search
MDKIAILTSGGDASGMNATIAYLTKYAIAKQLEVFYVKNGYYGLYHNHFITSKELDLTDF
FFMGGTVIGSSRFKQFQDPSLRKQAVLNLKKRGINNLVVIGGDGSYMGAKALSELGLNCF
CLPGTIDNDVNSSEFTIGFWTALEAIRVNVEAIYHTTKSHNRLAIIEVMGRDCSDLTIFG
GLATNASFVVTSKNSLDLNGFEKAVRKVLQFQNYCVVLVSENIYGKNGLPSLEMVKEHFE
NNAIKCNLVSLGHTQRGFSPNSIELFQISLMAKHTIDLVVNNANSQVIGMKNNQAVNYDF
NTAFNLPKADRTKLLNQVNTAII
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatagctattttaacttcgggtggtgatgctagtgggatgaatgccaccatc
gcttatctaaccaaatatgcaattgcaaagcaattggaagttttttatgtaaaaaacggt
tattatggcttgtatcacaaccattttatcaccagtaaggaacttgatttaactgacttt
ttctttatggggggaacagtaataggatcaagtcgtttcaaacagtttcaagatcctagc
ttacgaaaacaagcagttttaaacctcaaaaaacgtggtattaacaaccttgttgttatt
ggtggggatgggagttatatgggtgctaaagcactcagtgaattaggattaaactgcttt
tgtttacctggtacgatcgacaatgatgtcaattccagtgaatttaccattggtttttga
actgctttagaagcaattcgggttaatgttgaagcaatttatcacaccaccaaatcccat
aaccgcttagcaatcatagaagtgatggggcgtgattgtagtgatctgaccatctttggg
gggttagctactaatgctagttttgttgttactagcaaaaatagcttggatctcaatggc
tttgaaaaagcagtgagaaaggtgttgcaattccagaactattgtgttgttttggttagt
gaaaacatctatggtaagaacggtttacctagtttagaaatggttaaagagcactttgaa
aacaacgcaattaagtgtaacctagtttcactaggacacacccaaaggggctttagtcct
aatagtatcgaactctttcagattagtttaatggctaaacacacgattgatctggttgta
aataatgccaacagtcaagtaatagggatgaaaaacaaccaagcagttaactatgatttt
aacactgcttttaatttaccaaaagctgatagaaccaagttacttaaccaagttaacact
gcaattatttaa

DBGET integrated database retrieval system