KEGG   Mycoplasma genitalium G37: MG_225
Entry
MG_225            CDS       T00002                                 
Name
(GenBank) amino acid-polyamine-organocation (APC) permease family protein
Organism
mge  Mycoplasma genitalium G37
SSDB
Motif
Pfam: AA_permease_2 AA_permease DUF3671
Other DBs
NCBI-ProteinID: AAC71446
UniProt: P47467
Position
270405..271874
AA seq 489 aa
MGQINRKFSEKQFLLFVVNYIAGFGFIATAISLFRLGPFSWLIFLLVSLVSLIVTLSFAR
LSSIDSQNYGGPYLWAKKAVDKEKIAGRMFSFFTGWNNFIIGPLSAATAPLFILNSFSGI
DGIRGNLVNTWILIAIGFSFYVLLAFISTKGTSLNKKLIALFASVKWIVILSALIVAIYV
IARDGNGYSQNNNLESGFFGRREISFAQIATVFITFFYSYAGVEDISVMTPDVKTNNFRK
ILIVSFIAVFLFYFIGIIILNGLQNIAQRGGEANSIGNVADIFKKAAGLGTLIFYGVGAL
FNNVSTRLSTIIANSRKILPLAYDNYLPSFFYKQNKKGEFQNAIWFTFGTTLIAMTLLVF
IPLVASNFDFDNATEYAASVGSAATLLQYIFVFFIIFKFIYKKEPLYQKKWVKTTEELLF
CLGTIVIVLMLLVYLFPVIDGFSKWETKHTLTIVLYGVLSLIGLVLFLLQEYKHKNKQNA
NKQTTQTTV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgggtcaaatcaatcggaagtttagcgaaaagcagttcttactttttgttgttaactat
attgctggatttggctttattgctactgctatctcactgtttcgcttaggacctttttct
tggttaatctttctgcttgttagcttagttagtttaattgttaccttatcattcgcacgg
ctttcatcaatagatagtcaaaactatggtgggccttatctttgggctaagaaagcggtt
gataaagagaagatagcagggagaatgtttagcttttttacggggtgaaataactttatc
attggtcctctttcagcagcaactgcaccactttttatcctcaattcctttagtggtatt
gatgggattagaggtaacttagttaacacttgaatcctaattgcaataggtttttctttt
tatgtattactagcatttatctcaaccaaaggaacctcactaaacaagaaactaatagca
ctatttgcttcagtaaagtggattgtgatcctctcagcactaatagtagcaatctatgtt
attgctagagatggtaatggttatagtcaaaacaataacttagaaagtggtttttttggg
agaagagagattagttttgcacagatagcaacggtatttattaccttcttttattcttat
gcaggggttgaagatatctcagtgatgactcctgatgttaaaactaataactttagaaag
atattaattgtctcttttatagcagttttcctcttttatttcattgggattattattcta
aatggtttgcaaaacattgctcaaagaggtggggaagccaattcaattggtaatgtagcg
gatatctttaaaaaagctgctgggcttgggactttaatcttttatggagttggagcattg
tttaacaatgtctcaaccagactttcaactattattgccaactccagaaagattcttccg
cttgcttatgataactatttacctagtttcttttacaagcaaaacaaaaaaggtgagttt
cagaatgcaatttggtttacctttggtactactttaattgcaatgactttgcttgtcttt
atccctttagttgcttctaactttgattttgataatgctactgagtatgcagcatctgtt
ggctcagctgcaactttgctacaatatatttttgttttttttataatctttaagtttatc
tataaaaaagaaccactctaccagaaaaaatgggttaaaacaactgaagaattattgttt
tgtttaggaacaattgtcattgttttaatgttgttggtttatctgtttcctgttatagat
ggattttcaaaatgggaaactaaacacacattaacaattgtgttatatggggttttaagc
ctgataggattggtactttttttgctccaagaatacaaacataaaaacaagcaaaatgca
aacaaacaaacaacccaaacaacagtttag

DBGET integrated database retrieval system