KEGG   Mycoplasma genitalium G37: MG_226
Entry
MG_226            CDS       T00002                                 
Name
(GenBank) amino acid-polyamine-organocation (APC) permease family protein
Organism
mge  Mycoplasma genitalium G37
SSDB
Motif
Pfam: AA_permease
Other DBs
NCBI-ProteinID: AAC71447
UniProt: P47468
Position
271840..273318
AA seq 492 aa
MQTNKQPKQQFSEKQFIAFVFNYIAGFGFISVVMTMFDVGPFSYLVLGLTSFAILGVVLS
FSRLSVLCGNSAYGGSYLIAKKAVGTNSKTKRFFVFLSGWNVSLTGSFNGVVIPAVLIFS
FADIPVVKANNNIIIGLLVGGFLLFGLLTFISLFGLKINKKAIFYFAVIKWIVVIGGFIL
GIYLIGTTNGKGFVENNLIGTRENIDFFKIIFISLALTIAFAGTEDLASITPDVKSNNLR
KCFLIAFGCVVLLYLVGFVIISGLDGIRGYGLALGNKDPKAINNYGSIYRLVGGVPLLVI
YGLGLLVNSLASRLSMTITTARKYVALAQDGFLPSFLAKTNKHNEYHHAVLISNLMTLLV
MLIMVIIPFLPDHNNNNNSLFNAIEQLVTVTIEMAAAISLIQYFITFIFFFMIFAKKENQ
KLIPLWEKVSYVISFALVSVLLFVPLFPFNQWTVFNTFKIVVLICFYLLGVGFFGYAEWK
NKNKYQLMNNNS
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgcaaacaaacaaacaacccaaacaacagtttagtgaaaagcaattcattgcttttgtc
tttaactatattgctggatttggctttatatcagtggtgatgaccatgtttgatgttggg
ccattttcctatcttgttttagggttaacttcgtttgctattttaggagttgtgctttct
ttttctcgcctttcagttctctgtggtaatagtgcttatggagggagttatttaattgct
aaaaaagcagttggtactaacagtaaaacaaaaaggttttttgtttttttaagtgggtgg
aatgtatcgttaacaggatcttttaacggtgttgttattccagcagtattaatcttttcc
tttgcagatattccagtagttaaagcgaataataacatcattattggccttttagtaggt
gggtttttgttgtttggcttacttacttttatctcgttatttggtttaaaaattaacaag
aaagcaatcttttattttgctgttattaagtggatagtagtaataggtgggtttatctta
gggatctatttaattggtactaccaatggtaaaggttttgttgaaaacaatttaattggg
actagggaaaacattgattttttcaagattatctttattagtctggctttaaccattgct
tttgcagggacagaggatttagcttcgattactcctgatgtcaagtcaaataacttaaga
aagtgttttttaattgcctttgggtgtgttgtgttactttacctagttgggtttgttatt
atcagtggacttgatgggattagaggttatggattagcattaggtaataaagatcccaag
gcaattaataactatggatctatctaccgtttggtaggaggagttcctttacttgttatc
tatggacttgggttacttgtcaattccttagcatcacgcctatcaatgacaattacaaca
gctagaaaatatgtagctttagctcaagatgggtttttaccctcttttttagcaaaaact
aataaacataatgagtatcatcatgcagttttaattagtaatctaatgactttattagtg
atgctaattatggtaataatcccctttttaccagaccataacaacaataacaatagtttg
tttaatgctattgaacagttggttacagttaccattgaaatggctgcagccatttctttg
atccaatactttattacctttatcttcttttttatgatctttgctaaaaaggaaaaccag
aagttaattcccttgtgagaaaaggttagttatgtaattagctttgctttggtaagtgtg
ttgttgtttgtaccacttttcccttttaatcagtgaacagtgtttaacacctttaagata
gttgttctaatttgtttttatctacttggtgttggtttttttggttatgctgaatggaaa
aataaaaacaaataccaattaatgaataacaatagctaa

DBGET integrated database retrieval system