KEGG   Mycoplasma genitalium G37: MG_273Help
Entry
MG_273            CDS       T00002                                 

Gene name
pdhB
Definition
(GenBank) pyruvate dehydrogenase component E1, beta subunit
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge00010  Glycolysis / Gluconeogenesis
mge00020  Citrate cycle (TCA cycle)
mge00620  Pyruvate metabolism
mge01100  Metabolic pathways
mge01110  Biosynthesis of secondary metabolites
mge01120  Microbial metabolism in diverse environments
mge01130  Biosynthesis of antibiotics
mge01200  Carbon metabolism
Module
mge_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MG_273 (pdhB)
   00020 Citrate cycle (TCA cycle)
    MG_273 (pdhB)
   00620 Pyruvate metabolism
    MG_273 (pdhB)
Enzymes [BR:mge01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MG_273 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AAC71495
UniProt: P47515
Position
complement(331235..332215)
Genome map
AA seq 326 aa AA seqDB search
MSKIQVNNIEALNNAMDLALERDQNVVLYGQDAGFEGGVFRATKGLQQKYGSERVWDCPI
AENSMAGIGVGAAIGGLKPIVEIQFSGFSFPAMFQIFVHAARIRNRSRGVYTAPLVVRMP
MGGGIKALEHHSETLEAIYAQIAGLKTVMPSNPYDTKGLFLAAIESPDPVIFFEPKKLYR
AFRQEIPSDYYTVPIGEANLISEGSELTIVSYGPTMFDLINLVYSGELKDKGIELIDLRT
ISPWDKQTVFNSVKKTGRLLVVTEAVKSFTTSAEIITSVTEELFTYLKKAPQRVTGFDIV
VPLARGEKYQFEINARVIDAVNQLLK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatccaagtaaataacattgaagcgttaaacaacgcaatggatcttgcactg
gaaagagatcaaaacgttgtactctatggccaggacgctggttttgaagggggtgtgttc
cgtgcaactaaaggcttacaacaaaagtatgggagtgaaagggtatgggattgtcctata
gcagaaaactctatggctggtattggggttggggctgctataggtggtcttaaacctatt
gtagagatccagttttcaggcttttcattcccagctatgtttcaaatctttgtccatgct
gctaggattagaaaccgttctcgtggtgtatataccgctccactagtagtgaggatgcca
atgggtggggggattaaagcattggaacaccacagtgaaacattggaagcaatttatgca
cagattgctgggcttaaaacagtgatgccatcaaatccttatgataccaaaggacttttt
ctagctgctattgaatcacctgatcctgttatcttttttgaaccaaagaagctttatcgt
gcttttcgtcaggagattcctagtgattattacactgtccctattggtgaagccaacttg
attagtgaaggtagtgaacttacaatagttagctatggtcctacaatgtttgatttaatt
aacttagtttacagcggggaattgaaagataagggaattgagttaattgacttgcgtact
atctccccttgagataaacaaacagtatttaactcagtgaagaaaacaggaagactactt
gtagtgactgaagcggtgaaaagtttcactacaagtgcagagattatcacttcagtaact
gaagaactattcacttatctcaaaaaagccccacaacgggtaactgggtttgatattgtt
gtgcctttagctagaggtgaaaaataccagtttgaaattaatgcacgggttattgatgca
gttaatcaacttttaaaataa

DBGET integrated database retrieval system