KEGG   Mycoplasma gallisepticum F: MGF_2611Help
Entry
MGF_2611          CDS       T01924                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgf  Mycoplasma gallisepticum F
Pathway
mgf00010  Glycolysis / Gluconeogenesis
mgf00030  Pentose phosphate pathway
mgf00051  Fructose and mannose metabolism
mgf00052  Galactose metabolism
mgf00680  Methane metabolism
mgf01100  Metabolic pathways
mgf01110  Biosynthesis of secondary metabolites
mgf01120  Microbial metabolism in diverse environments
mgf01130  Biosynthesis of antibiotics
mgf01200  Carbon metabolism
mgf01230  Biosynthesis of amino acids
mgf03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mgf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGF_2611 (pfkA)
   00030 Pentose phosphate pathway
    MGF_2611 (pfkA)
   00051 Fructose and mannose metabolism
    MGF_2611 (pfkA)
   00052 Galactose metabolism
    MGF_2611 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MGF_2611 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MGF_2611 (pfkA)
Enzymes [BR:mgf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MGF_2611 (pfkA)
Protein phosphatases and associated proteins [BR:mgf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MGF_2611 (pfkA)
Messenger RNA biogenesis [BR:mgf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MGF_2611 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 DAGK_cat Glycos_transf_1 LYTB
Motif
Other DBs
NCBI-ProteinID: ADC31285
Position
439665..440663
Genome map
AA seq 332 aa AA seqDB search
MAIQTQRIAILTSGGDSPGMNPAIYGLVQQAIINNIQPYLVYEGYKGLVEDQIVLANQQE
VIDHFFDSGTFIYSARLVEFKDLEVRKKAVSNLKAKKIDTLVVIGGDGSYQGAKLLSEMG
INVIVMPGTIDNDVSSSDYTIGFYSALEHITRTIQEIISTSVSHNRVSISEVMGRHCGDL
AVYAALATKADLVITSENIKTTQEIVDLAAKRMLQDHKRTFTVIVCEHIYGEDGRDSLKT
IAQQINDQLGIKTNLNILTYGQRGQVPTPMERILAMKFAIKAFECINEQRYGVVLGLSGD
EIVAYNFQEALNKRNPSRIKLINLSNRINGGF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccattcaaacacaacgaattgcgatcttaacttctggaggagattctccaggaatg
aatccagcaatttatgggttagttcaacaagcgatcattaataatattcaaccttactta
gtttatgaaggttataaaggcttagttgaagatcagatcgttcttgctaaccaacaagaa
gtgatcgaccatttctttgattcgggaacgtttatttattcagcaagattagttgaattc
aaagatcttgaagtaagaaaaaaagcagtaagtaaccttaaagcaaaaaaaatcgatacg
ttagtagtgatcggtggtgatggttcatatcaaggcgcaaaactattatctgagatgggg
attaatgtgattgtgatgcctggaacgattgataatgatgtatcttcatcagattacaca
atcggtttttattcagcattagaacatattactagaacgattcaagagatcatctcaact
agtgtttctcacaaccgggtatcgatctctgaagtgatgggacgtcattgtggggattta
gcagtttatgcagcacttgcaactaaagctgatctagtaattacctcagaaaatatcaaa
acaacccaagagatcgtagatcttgctgctaaaagaatgttacaagatcacaaacgcaca
tttactgtgatcgtttgtgaacatatttatggtgaagatggcagggatagtttaaaaacg
atcgcccaacagattaatgatcagttaggaattaaaactaatcttaatatcttaacctac
ggtcaacgtggtcaagttcccacaccgatggaacggattctagccatgaaatttgcgatt
aaagcgtttgaatgtattaacgaacaaagatacggcgttgttttaggtttaagtggggat
gagatcgtagcttacaatttccaagaagcactaaataaacgtaatccttcaagaatcaaa
ttaattaatttaagcaatagaataaacggtggtttttaa

DBGET integrated database retrieval system