KEGG   Mycoplasma gallisepticum F: MGF_5007Help
Entry
MGF_5007          CDS       T01924                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mgf  Mycoplasma gallisepticum F
Pathway
mgf00230  Purine metabolism
mgf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MGF_5007 (gmk)
Enzymes [BR:mgf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MGF_5007 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 Rad17 AAA_16 RsgA_GTPase AAA_29 AAA_22 SRPRB ABC_tran NTPase_1 NB-ARC Roc AAA_17 AAA SpoU_sub_bind DUF3179 DFF40 DUF4142 ATP-synt_ab MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ADC31613
Position
complement(851292..851879)
Genome map
AA seq 195 aa AA seqDB search
MVVIYIMSNKQGLIILISGPSGVGKGTIVSRLLSDNNLKLNVSISATTRKKRASEVEGVH
YFFKTKEEFEQMIANNQLLEYANYVNNYYGTPLSLVKEILDKNENLILEIEYQGVIQVLK
KGFRTLSIFVLPPSEDELVARLKKRGTENDEVIKYRLKQAVKEYAHRELYDHTIINDDLE
KTIQDIKQLILKYNQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggtagttatatatattatgagtaacaagcagggtttaattatcttaatatctggtcct
agtggggttggtaagggcacgatagttagtaggcttttgtctgacaacaacttaaaacta
aacgtttcaatttcagccacaacaagaaaaaagcgagcatctgaagttgaaggcgtgcat
tattttttcaaaactaaagaagagtttgaacaaatgattgccaacaaccaattattagag
tatgctaactacgttaataactattatggaacaccgctttcattagttaaagagatcctt
gataaaaacgaaaacctaattttagagattgaataccaaggggtgattcaagtcttaaaa
aaaggttttagaacactaagtatctttgtgcttcccccttctgaagatgagttagttgca
cgactaaaaaagcggggaactgagaacgacgaagtaattaaataccgcttaaaacaagcc
gttaaagaatatgcccatagagaactttatgatcatacgatcattaatgatgatctagaa
aaaacgatccaagatattaaacaactaattcttaagtataatcaataa

DBGET integrated database retrieval system