KEGG   Micropruina glycogenica: MPLG2_2330Help
Entry
MPLG2_2330        CDS       T05338                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mgg  Micropruina glycogenica
Pathway
mgg00051  Fructose and mannose metabolism
mgg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MPLG2_2330 (mtlD)
Enzymes [BR:mgg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     MPLG2_2330 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: SPD87360
UniProt: A0A2N9JGZ3
Position
1:complement(2255101..2256240)
Genome map
AA seq 379 aa AA seqDB search
MKAVHFGAGNIGRGFVGLLLSNAGYELVFADVADALIEALANSDSYAVHEVGDDPRTTVV
RGYSALNSAKQAEELTAAIASADIVTTAVGAHILKFVAPAIAAGIAARPTGSPKLAVMAC
ENAINGTDILKGEVEAAYAGDDLADRALFANTAVDRIVPAQDPNAGLDVTVENYFEWAIE
TPPFEGNVPEIDGVTWVDDLEPYIERKLFTVNTGHATAAWFGYAAGIEKISDALADADVT
AKVADALADTKSLIVAKHGVDDAVQTAYVSKILKRFANPSLPDTTLRVGRGPLRKLSRHD
RFISPASQLAERGMPYNGLLAAIGAGLGFDNADDPEAVELQRLLGELSPEDAVAQITGLT
EADALYPAVLEVVRNHQQG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggtccacttcggcgcgggaaacatcggtcgcgggttcgtcggcctgctgctc
agcaacgccggctacgaactggtcttcgcagacgtcgccgacgcgctgatcgaggcgctg
gcgaactccgattcgtacgccgtgcacgaggtgggtgatgacccgcgcaccaccgtggtg
cgcgggtactccgctctcaactcggccaagcaggctgaggagttgaccgccgcgatcgcc
tcggccgacatcgtcaccacagctgtcggagctcacattctgaagttcgtggccccggcc
atcgcggcgggtatcgcggcccgtccgaccgggtcacccaagttggcggtgatggcctgt
gagaacgccatcaacggcaccgacattctgaagggcgaggtcgaggcggcctacgccggt
gacgatctggccgaccgggcgttgttcgccaacaccgcggtcgaccgcatcgtgccggcc
caagacccgaacgcggggctcgacgtcacggtcgagaactacttcgagtgggccatcgag
acgccgccgttcgagggcaacgtgcccgagatcgacggcgtcacctgggtggacgacctg
gagccctacatcgaacgcaagttgttcacggtgaacaccggccacgccaccgcggcctgg
ttcggctacgccgctggcatcgagaagatctcggacgcgctcgctgacgccgacgtgacc
gccaaggtcgccgacgcattggccgacaccaagtcgttgatcgtcgccaagcacggcgtc
gacgatgcggtgcagaccgcctacgtgagcaagatcctcaagcggttcgccaacccgagc
ctgcccgacaccaccctgcgggtgggtcgtgggccgctgcgcaagctgagccggcatgac
aggttcatttcgccggcgtcgcagttggctgagcggggcatgccctacaacggactgctg
gcggcgatcggcgcgggtctcggtttcgacaatgctgacgaccccgaagccgtcgagctg
caacggctgctgggggagttgtcacccgaagatgcggtggcgcagatcaccggcctgacc
gaggccgacgccctctacccggcggtgttggaggtcgttcgcaaccaccagcagggctga

DBGET integrated database retrieval system