KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0433Help
Entry
Mflv_0433         CDS       T00498                                 

Definition
(GenBank) Arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Mflv_0433
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mflv_0433
Enzymes [BR:mgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     Mflv_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: ABP42927
UniProt: A4T3U5
Position
complement(451116..451943)
Genome map
AA seq 275 aa AA seqDB search
MSRLSDAYLSRIGFSGPAAATVDTLRRIVAAHNAAIPFENLDPLMGVPVVDLSAEALSDK
LIGRRRGGYCYEHNGLLGYVLEDLGYAVERLVGRVVWMHEGDALPAQTHQVLAVTLPDGY
GPWLVDVGFGGQTLTSPIRLQTGVVAQTRHEPYRLLDHADGMQLQALIRDVWQPLYLLDP
APRPRIDLEVGSWYVSTFPRSGFVTGLTAALVTDDARWNLRGRHLAVHRAGGTEKTRLDT
AAEVMELLATRFGIDLDDLGNRADVASRITAVLDT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtctgtccgacgcgtatctctcccgtatcgggttctccggtcccgctgccgcg
accgtcgacaccctgcggcgcatcgtcgccgcccacaatgccgccatcccgttcgagaac
ctcgatccgctgatgggggtcccggtggtcgatctgtcggcagaagcgttgtcggacaag
ctcatcggtcggcgccgcggcggctactgctacgaacacaacggattgctcggctacgtc
ctcgaagatctcggctacgcggtggaacgtctcgtcggccgcgtcgtctggatgcacgaa
ggtgacgccctccccgcccagacccatcaggtgctggcggtgacgctgccggacggctac
gggccctggctcgtcgacgtcggattcggcggccagacactgacgtcgccgatccggttg
cagaccggcgtcgtcgcccagacccggcacgagccctaccggctgctcgaccacgccgac
gggatgcagctgcaggccttgatccgcgatgtctggcagccgctgtacctgctcgacccg
gccccccgcccgcggatcgacctcgaggtgggcagctggtacgtgtcgacgttcccgcgg
tcgggcttcgtcaccgggctcaccgccgcgctggtcaccgacgacgcccgctggaacctg
cgcggcaggcatctcgccgtgcaccgcgcgggcggcacggagaagacccgcctggacacc
gcggccgaggtgatggagttgcttgcgacgcgattcgggatcgacctggacgatctcgga
aaccgtgccgacgtggcgtcgcgcatcaccgccgtcctcgacacctga

DBGET integrated database retrieval system