KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_1522Help
Entry
Mflv_1522         CDS       T00498                                 

Definition
(GenBank) pyruvate carboxyltransferase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00360  Phenylalanine metabolism
mgi00362  Benzoate degradation
mgi00621  Dioxin degradation
mgi00622  Xylene degradation
mgi01100  Metabolic pathways
mgi01120  Microbial metabolism in diverse environments
mgi01220  Degradation of aromatic compounds
Module
mgi_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Mflv_1522
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mflv_1522
   00622 Xylene degradation
    Mflv_1522
   00621 Dioxin degradation
    Mflv_1522
Enzymes [BR:mgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Mflv_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm ZnuA
Motif
Other DBs
NCBI-ProteinID: ABP44004
UniProt: A4T7U4
Position
1588674..1589732
Genome map
AA seq 352 aa AA seqDB search
MSTEDIYFNPIWDVRMTDTSLRDGSHHKRHQFTKDEVGSIVAALDAAGVPVIEVTHGDGL
GGSSFNYGFSKTPEQELIKLAAETAKESKIAFLMLPGVGTKEDIKEAQNNGGSICRIATH
CTEADVSIQHFGLARELGLETVGFLMMSHTISPEKLAKQARIMADAGCQCVYVVDSAGAL
VLEGVADRVSALVAELGDDAQVGFHGHENLGLGVANSIEAVRAGAKQIDGSCRRFGAGAG
NAPVEALIGVFDKIGVKTGIDFFDIADAAEEVVAPAMPAECLLDRNALIMGYSGVYSSFL
KHAIRQSERYGVPAHQLLHRAGQRKLIGGQEDQLIDIALEIKREQEAEATRA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaggacatctacttcaacccgatctgggacgtccgcatgacggacacgtcg
ctgcgcgacggttcgcaccacaaacgccatcagttcaccaaggacgaggtcggctcgatc
gtcgcggccctcgacgcggcgggcgtacccgtcatcgaggtcacccacggcgacgggctc
ggcgggtcgagcttcaactacgggttctccaagaccccggagcaggagctgatcaagctg
gccgccgagacggccaaggaatcgaagatcgctttcctgatgctgcccggggtgggcacc
aaggaggacatcaaagaggcccagaacaacggtggctcgatctgccggatcgcgacccac
tgcaccgaggccgacgtgtccattcagcatttcgggctggcgcgtgaactgggcctggag
actgtcggcttcctgatgatgagccacaccatctcgccggagaagctcgccaagcaggcg
cgcatcatggccgacgcgggctgccagtgcgtctacgtcgtcgactcggcgggcgcgctc
gttctcgaaggggtcgccgatcgcgtatcggctttggtcgcagaactcggcgacgacgct
caggtcggcttccatggccacgagaacctgggcctcggggtcgccaattcgatcgaggcc
gtgcgcgcgggcgccaagcagatcgacggctcgtgccgccggttcggcgcgggcgccggc
aacgcgccggtcgaggcgctcatcggcgtgttcgacaagatcggcgtcaagacgggcatc
gacttcttcgacatcgccgatgcggccgaggaggtcgtcgcccctgcgatgccggccgaa
tgcctgctggaccgcaacgcgctgatcatgggttactcgggtgtgtactccagcttcctc
aagcacgcgatccgtcagtcggagcgctacggtgtgcctgcgcaccagcttctgcaccgc
gcgggtcagcgcaagctgatcggtggccaggaggaccagctgatcgatatcgcgctggag
atcaagcgcgaacaggaagccgaggcgacgcgcgcctga

DBGET integrated database retrieval system