KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1692Help
Entry
Mflv_1692         CDS       T00498                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00071  Fatty acid degradation
mgi00280  Valine, leucine and isoleucine degradation
mgi00281  Geraniol degradation
mgi00310  Lysine degradation
mgi00362  Benzoate degradation
mgi00380  Tryptophan metabolism
mgi00410  beta-Alanine metabolism
mgi00640  Propanoate metabolism
mgi00650  Butanoate metabolism
mgi00903  Limonene and pinene degradation
mgi00930  Caprolactam degradation
mgi01040  Biosynthesis of unsaturated fatty acids
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01130  Biosynthesis of antibiotics
mgi01200  Carbon metabolism
mgi01212  Fatty acid metabolism
Module
mgi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mflv_1692
   00650 Butanoate metabolism
    Mflv_1692
  Lipid metabolism
   00071 Fatty acid degradation
    Mflv_1692
   01040 Biosynthesis of unsaturated fatty acids
    Mflv_1692
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mflv_1692
   00310 Lysine degradation
    Mflv_1692
   00380 Tryptophan metabolism
    Mflv_1692
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mflv_1692
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mflv_1692
   00281 Geraniol degradation
    Mflv_1692
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mflv_1692
   00930 Caprolactam degradation
    Mflv_1692
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mflv_1692
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mflv_1692
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mflv_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored AlaDh_PNT_C NAD_binding_8 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABP44174
UniProt: A4T7C7
Position
1757144..1759297
Genome map
AA seq 717 aa AA seqDB search
MAENTIKWDKDADGIVTLTLDDPTGSANVMNEHYKASMHDAVERLVAEKDSVSGVVIASA
KKTFFAGGDLKGMMNVGPDNAAESFAEVEFIKADLRKLETLGVPVVAAINGAALGGGLEI
ALACHHRIAADTRGVVIGLPEVTLGLLPGGGGVARTVRMFGIQKAFMEILSQGTRFKPGK
AKEIGLVDELVDSVEELVPAAKAWIKANPEAHTQPWDQKGYKMPGGTPSSPGLASILPSF
PALLKKQLKGAPMPAPRAILDAAVEGAQVDFDTATRIESRYFVGLVTGQTAKNMIQAFFL
DLQAINGGASRPDGIAKQEIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVSIEAAQKGK
AYSEKIEAKALERGKTTKEKSDALLARITPAADAADLKGVDFVIEAVFENQELKHKVFQE
IEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVPAASIEQAGAQAGYP
AAPLQLSDELNLELMQKIATETRKATEAAGGTHVAHPAEEVVNKMIEIGRPSRLKGAGFY
EYVDGKRVGLWPGLADTFGSGSGAVDIPLQDMIDRMLFAEALETQKCLDEGVLTSTADAN
IGSIMGIGFPPYTGGSAQFIVGYQGELGVGKEAFVARAKQLAERYGERFNPPASLTS
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacaccatcaagtgggacaaggatgccgacggcatcgtcacgctgacgctg
gacgacccgaccgggtcggccaacgtgatgaacgagcactacaaggcttcgatgcatgac
gccgtcgaacgccttgtcgccgagaaggattcggtctccggcgtggtgatcgccagcgcg
aagaagaccttcttcgccggcggtgacctcaagggcatgatgaacgtcggcccggacaac
gcggcggagtccttcgccgaggtcgagttcatcaaggccgacctgcgcaagctggagacc
ctcggtgtacccgtcgtcgcagccatcaacggcgccgccctcggcggcggcctggagatc
gcgctggcgtgtcaccaccgcatcgccgccgacacccgcggtgtcgtgatcggccttccc
gaggtcaccctcgggctgctgcccggcggcggtggcgtggcccgcaccgtgcggatgttc
ggcatccagaaggcgttcatggagatcctgtcgcagggaacgcgtttcaagccgggcaag
gccaaggagattggtctggtcgatgagttggtcgacagcgtcgaggaactcgtccccgcc
gccaaggcgtggatcaaagcgaatccggaagcccacacccagccgtgggatcagaagggc
tacaagatgcccggcggcacgccgagcagcccgggcctggcgtcgatcctgccgtccttc
ccggcactgctgaagaagcagctcaagggtgccccgatgccggccccgcgcgcgatcctc
gacgccgccgtcgaaggcgcccaggtggacttcgacaccgccacccgcatcgagagccgc
tacttcgtcggcctggtgaccggccagaccgcgaagaacatgatccaggccttcttcctg
gatctgcaggccatcaacggcggcgcctcgcggcccgacggtatcgccaagcaggagatc
aagaagatcggtgtgctcggcgcgggcatgatgggcgccggaatcgcctacgtctcggcc
aaggccggctatgacgttgtgctgaaggatgtttcgatcgaagcggcgcagaagggcaag
gcgtactcggagaagatcgaggccaaggcgctcgagcgtggcaagacgaccaaggagaag
tcggacgcgctgttggcccggatcacccccgccgccgacgccgccgatctcaaaggcgtc
gacttcgtgatcgaggccgtcttcgagaaccaggaactcaagcacaaggtgttccaggag
atcgaggacatcgtcgaaccgaacgcgctgctgggctcgaacacctccacgctgccgatc
accggtctggcgaccggcgtgaaacgccaggaggacttcatcgggatccacttcttctca
cccgtcgacaagatgccgctggtggagatcatcaagggcgagaagacctctgacgaggca
ctggcgcgggtgttcgactacacgctggccatcggcaagaccccgatcgtggtcaacgac
agccgtgggttcttcacctcccgcgtcatcggcacgttcgtcaacgaggcgttggcgatg
ctcggcgagggtgtgccggcggccagcatcgagcaggcgggtgcgcaggccggctacccg
gcggcgccgctgcagctctccgacgagctcaacctggagctcatgcagaagatcgccacc
gagacccgcaaggcgaccgaggcggcgggcggcacccacgtggcgcacccggccgaggag
gtcgtcaacaagatgatcgagatcggtcgtccgtcgcggctcaagggtgcgggcttctac
gagtacgtcgacggcaagcgcgtcggcctgtggccgggtctcgccgacacgttcgggtcg
ggctccggcgcggtcgatatcccgttgcaggacatgatcgaccgcatgctgttcgccgag
gcgctggagacccagaagtgcctcgacgaaggcgtgctcacctcgaccgccgacgccaac
atcggctccatcatgggtatcggcttcccgccgtacaccggtggttcggcgcagttcatc
gtcggctaccagggcgagctcggtgtcggtaaggaggcgttcgtcgcgcgggccaagcag
ttggccgagcgctacggcgagcggttcaacccgccggcctcgctgacgtcctaa

DBGET integrated database retrieval system