KEGG   Mycobacterium gilvum PYR-GCK: Mflv_2040Help
Entry
Mflv_2040         CDS       T00498                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00071  Fatty acid degradation
mgi00072  Synthesis and degradation of ketone bodies
mgi00280  Valine, leucine and isoleucine degradation
mgi00310  Lysine degradation
mgi00362  Benzoate degradation
mgi00380  Tryptophan metabolism
mgi00620  Pyruvate metabolism
mgi00630  Glyoxylate and dicarboxylate metabolism
mgi00640  Propanoate metabolism
mgi00650  Butanoate metabolism
mgi00900  Terpenoid backbone biosynthesis
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01130  Biosynthesis of antibiotics
mgi01200  Carbon metabolism
mgi01212  Fatty acid metabolism
mgi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mflv_2040
   00630 Glyoxylate and dicarboxylate metabolism
    Mflv_2040
   00640 Propanoate metabolism
    Mflv_2040
   00650 Butanoate metabolism
    Mflv_2040
  Lipid metabolism
   00071 Fatty acid degradation
    Mflv_2040
   00072 Synthesis and degradation of ketone bodies
    Mflv_2040
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mflv_2040
   00310 Lysine degradation
    Mflv_2040
   00380 Tryptophan metabolism
    Mflv_2040
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mflv_2040
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mflv_2040
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mflv_2040
Enzymes [BR:mgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mflv_2040
Exosome [BR:mgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mflv_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt OmpA_membrane
Motif
Other DBs
NCBI-ProteinID: ABP44518
UniProt: A4T9C5
Position
complement(2118059..2119276)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVATARSPIGRANKGSLVAMRPDDLAAQMVRAALDKVPSLDPRDIDDLMMGCAQP
AGEAGYNIARAVAVELGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGHAFISAGVETV
SRFGKGAADGAPDSKNPIFADAQERSAKAAEGAEEWHDPREDGLLPDVYIAMGQTAENVA
AFTGISREDQDHWGVRSQNRAEEAINSGFFDREIVPVTLPDGTVVSKDDGPRAGTSYDKI
SQLKPVFRPNGTITAGNACPLNDGAAAVVIMSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEAVKKALANAKMSISDIDLYEINEAFAVQVLGSARELGMDEDKLNVSGGAIALGH
PFGMTGARITATLLNNLATHDKTFGIESMCVGGGQGMAMVVERLS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgtcatcgtcgccaccgcacgttcacccatcggcagggccaacaagggc
tcgctggtggcgatgcgtcccgacgatctcgccgcccagatggtccgcgcggcgctggac
aaggtgccgtcgctggacccgcgcgacatcgacgacctgatgatgggctgcgcgcagccc
gccggtgaggccggctacaacatcgcgcgggccgtcgccgtcgagctcggctacgacttc
ctgcccggcacgaccgtgaaccggtactgctcgtcgtcgctgcagaccacgcggatggcg
ttccacgcgatcaaggccggcgagggccacgcgttcatctcggccggcgtcgagacggtg
tcgcggttcggcaagggtgcggccgacggcgcgccggactcgaagaacccgatcttcgcc
gacgcgcaggagcggtcggccaaggccgccgagggtgccgaggaatggcacgatccgcgc
gaggacgggctgctgcccgacgtgtacatcgcgatgggtcagaccgccgagaacgtcgcg
gcgttcaccggaatcagccgtgaggaccaggaccactggggcgtgcgttcgcagaaccgc
gcggaagaggcgatcaacagcggcttcttcgaccgcgagatcgtgccggtgacgctgccg
gacggaaccgtggtgtccaaggacgacgggccgcgcgcgggtaccagctacgacaagatc
agccagctcaagccggtgttccggcccaacggcacgatcaccgccggcaatgcgtgcccg
ctcaacgacggcgccgccgcggtcgtcatcatgagcgacaccaaggccaaggaactcggc
ctgaccccgctggcgcgcatcgtctccacgggtgtgtcgggtctgtcgcccgagatcatg
ggcctgggccccatcgaagccgtcaagaaggcgctcgccaacgcgaagatgagcatctcc
gacatcgacctctacgagatcaacgaggcgttcgcggtgcaggtgctcggctcggcccgt
gagctcggcatggacgaggacaagctcaacgtgtccggcggcgcgatcgcgctgggtcac
ccgttcggcatgaccggcgcccgcatcaccgcgacgctgctcaacaacctcgccacccat
gacaagacgttcggcatcgagtcgatgtgcgtcggcggcgggcagggcatggcgatggtc
gtggagcggctctcctag

DBGET integrated database retrieval system