KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_2050Help
Entry
Mflv_2050         CDS       T00498                                 

Definition
(GenBank) LmbE family protein
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mflv_2050
Enzymes [BR:mgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     Mflv_2050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ABP44528
UniProt: A4T9C4
Position
2127940..2128815
Genome map
AA seq 291 aa AA seqDB search
MSELRLMAVHAHPDDESSKGAAAMARYVDEGVRVMVVTLTGGERGDILNPAMDLPEVHGR
IHEIRIDEMARAAEILGVEHHWLGFVDSGLPEGDPLPPLPEGCFALEPLEVPTEALVKVI
RDFRPHVMTTYDENGGYPHPDHIKCHQVSVAAYEAAADHLLYPDAGEPWSVSKLYYNHGF
LRQRMQVLQDEFAKHGEEGPFAKWLEKWDPDDDVLDKRVTTRIECAKYFGKRDDALLAHA
TQIDPNSFFFTTPMEWQQRLWPTEEFELARSRVPVVLPETDLFAGIEDLGD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgaactccgcttgatggccgtgcacgcgcacccggatgacgagtccagcaagggt
gccgcggcgatggcgcgctacgtcgacgagggcgttcgggtgatggtcgtgaccctgacc
ggcggcgagcgcggcgacatcctcaacccggcgatggacctgcccgaggtgcacggacgt
atccacgagatcaggatcgacgagatggcgcgggccgcggagatcctcggtgtcgaacac
cactggctcgggttcgtcgactccgggttgcccgagggcgacccgctgccgccactgccg
gagggctgcttcgcgctggagccgctcgaggtgcccaccgaggcgctggtcaaggtgatc
cgcgacttcaggccccacgtcatgaccacctatgacgagaacggcggctatccgcacccc
gaccacatcaagtgccatcaggtgtcggtcgccgcgtacgaggcggccgccgaccatctg
ctctacccggacgccggtgagccgtggagtgtgtccaagctctactacaaccacggcttc
ctccggcagcggatgcaggtcctgcaggatgagttcgccaagcacggcgaagagggcccg
ttcgcgaagtggctggagaagtgggatcccgacgacgacgtcctcgacaagagggtgacg
acgcggatcgagtgcgcgaagtacttcgggaagcgggacgacgcactcctcgcccatgcg
acacagatcgacccgaacagtttctttttcaccactccgatggagtggcaacagcggctc
tggccgacggaggagttcgaactggcgcggtccagggtgccggtggtgctgcccgagacc
gacctgttcgccgggatcgaggatttgggtgactga

DBGET integrated database retrieval system