KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_2296Help
Entry
Mflv_2296         CDS       T00498                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00970  Aminoacyl-tRNA biosynthesis
Module
mgi_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mflv_2296
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgi01007]
    Mflv_2296
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mgi03016]
    Mflv_2296
   03029 Mitochondrial biogenesis [BR:mgi03029]
    Mflv_2296
Enzymes [BR:mgi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Mflv_2296
Amino acid related enzymes [BR:mgi01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Mflv_2296
Transfer RNA biogenesis [BR:mgi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Mflv_2296
 Prokaryotic Type
   Other AARSs
    Mflv_2296
Mitochondrial biogenesis [BR:mgi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mflv_2296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f HIRAN
Motif
Other DBs
NCBI-ProteinID: ABP44774
UniProt: A4T8M4
Position
2387106..2388758
Genome map
AA seq 550 aa AA seqDB search
MTPADLAQLLKATAAAVLAEHGLDSAALPDTVTVERPRNPEHGDYATNLALQLGKKVGAN
PRELAGWLAEALAASDGIAAADVAGPGFVNLRIEASAQNVMVSNVLSAGADYGHSAVLAG
KKVNLEFVSANPTGPIHIGGTRWAAVGDALGRLLTTQGAAVTREYYFNDHGAQIDRFSNS
LIAAAKGEPAPEDGYAGTYIADIASQVVAKEPGVLDQPDDRMRETFRAIGVNLMFDHIKE
SLHEFGTDFDVYTHEDSMHTSGRVEQAIDKLRETGFAYEKDGAVWLRTTDFGDDKDRVVI
KSDGKPAYIAGDLAYFLDKRKRGFDLCIYMLGADHHGYIARLKASAAALGDDPDTVEVLI
GQMVNLVRDGQPVRMSKRAGTVITLDDLVEAIGVDAARYSLIRSSVDTPIDIDLELWSSA
SNENPVYYVQYAHARLSALARNAAELGIAPDTAHLDLLTHDKEGVLIRNIGEFPRILATA
AELREPHRVSRYLEDLAGDYHRFYDACRVLPQGDEAPGDLHAARLALCAATRQVIANGLD
ILGVSAPERM
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgacccctgccgatctggcccaactgctcaaggccaccgccgccgcggtgctcgccgag
cacggcctcgactccgccgcgctgcccgacaccgtcaccgtcgagcgtccccgcaacccc
gagcacggtgactacgcgaccaacctggcgcttcagctcggcaagaaggtcggggcgaac
ccccgcgagctcgccggctggctggccgaggccctggccgcgtccgacggcatcgccgcg
gccgacgtggccggtcccgggttcgtcaatctgcgcatcgaggcctccgcacagaacgtc
atggtcagcaatgtgctgagcgccggagcggactacggtcactccgcggtgctcgccggc
aagaaggtcaacctcgagttcgtctccgcgaaccccacgggcccgatccacatcggcggg
acccgctgggcggccgtcggcgacgccctcggtcgattgctgaccacgcagggcgccgcg
gtcacccgcgagtactacttcaacgatcacggtgcgcagatcgaccggttcagcaattcg
ctcatcgccgccgcgaagggtgaacccgcccccgaggacggctatgccggcacctacatc
gccgacatcgcgagccaggtggtcgcgaaggagcccggtgtcctcgaccagcccgacgat
cggatgcgcgagacgttccgggccatcggcgtgaacctgatgttcgaccacatcaaggaa
tcgctgcacgagttcggcaccgacttcgacgtctacacccacgaagactcgatgcacacc
tccggccgcgtggagcaggccatcgacaagctgcgggagaccggcttcgcctacgagaag
gacggcgcagtctggttgcgcaccaccgacttcggtgacgacaaggaccgcgtcgtgatc
aagagcgacggcaaaccggcctacatcgccggcgacctcgcctacttcctggacaagcgc
aagcgcggattcgacttgtgtatctacatgctcggcgcggaccaccacgggtacatcgcg
cggctgaaggcgtcggcggccgccctcggcgacgatcccgacaccgtcgaggtgctcatc
ggccagatggtcaacctcgtccgcgacggccagccggtccggatgagcaagcgcgccggc
accgtcatcaccctcgacgacctcgtcgaggccatcggcgtggacgccgcccgctactcg
ctgatccgcagttcggtcgacaccccgatcgacatcgacctcgagctctggtcctcggca
tccaacgagaacccggtctactacgtgcaatacgcccacgcgcggctctcggcactggcc
cgcaacgccgcagagctcgggatcgcgcccgacacagcacatctcgacctgctgacgcac
gacaaggaaggcgtgctgatccgcaacatcggcgaattcccgcgcatcctggcgacggcc
gccgaactgcgtgagccgcatcgtgtctcgcgctatctggaggatctcgccggggactat
caccggttctacgacgcgtgccgggtgctgccgcagggtgatgaggctccgggtgacctg
cacgcggcgcgtcttgcgctgtgcgccgcgacgcgtcaggtgatcgccaacgggctcgac
atcctcggcgtcagcgctccggagcggatgtga

DBGET integrated database retrieval system