KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_2430
Entry
Mflv_2430         CDS       T00498                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00903  Limonene and pinene degradation
mgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mflv_2430
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     Mflv_2430
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: ABP44907
UniProt: A4T891
Position
complement(2533503..2534339)
AA seq 278 aa
MAGRVEGKVAFITGAARGQGRAHAVRLAEEGADIIAVDICKQIDSVLIPLSTPEDLAETA
DLVKNAGGRIHTAEVDVRDYDALKAAVDAGVEEFGRLDIIVANAGIGNGGQTLDKTDEPD
WDDMIGVNLSGVWKTVKAGVPHILAGGNGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGL
MRTFAVELGAQNIRVNSVHPTNVNTPLFMNEPTMKLFRPDLENPGPDDMKVVGQLMHTLP
IGWVEPEDIANAVLFLASDEARFITGVTLPVDGGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcaggacgcgtagaaggcaaggtcgctttcatcaccggtgcggcacgcggacaggga
cgtgcccacgcggtacggctcgccgaagagggcgccgatatcatcgccgtcgacatctgc
aagcagatcgacagcgtgctgatcccgttgtccacgccggaggatctcgccgagacggcc
gatctggtcaagaacgccggcggccgcatccacaccgccgaggtcgacgtgcgtgactac
gacgcactgaaggccgccgtcgacgccggcgtcgaggagttcggcaggctcgacatcatc
gtggccaacgccggcatcggcaacggcggacagacgctcgataagacggacgagcccgac
tgggacgacatgatcggtgtcaacctgtccggcgtgtggaagaccgtcaaagccggtgtg
ccgcacatcctcgccggcggcaacggcggctcgatcatcctgaccagctcggtcggtggc
ctcaaggcctacccgcacaccggccactacgtcgccgccaagcacggcgtcgtcggcctg
atgcggacattcgcggtcgagctgggcgcgcagaacatccgcgtcaactcggtccacccg
accaacgtcaacacccctctgttcatgaacgagcccacgatgaagctgttccggccggac
ctggagaacccgggcccggacgacatgaaggtcgtcggccagctgatgcacacgctgccg
atcggctgggtggagcccgaggacatcgcgaacgccgtgctgttcctggcctccgacgag
gcacgcttcatcaccggcgtcaccctgcccgtcgacggcggcagctgcctgaagtga

DBGET integrated database retrieval system