KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3598Help
Entry
Mflv_3598         CDS       T00498                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00260  Glycine, serine and threonine metabolism
mgi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01130  Biosynthesis of antibiotics
mgi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mflv_3598
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mflv_3598
Enzymes [BR:mgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mflv_3598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ABP46072
UniProt: A4T9P3
Position
complement(3841513..3842301)
Genome map
AA seq 262 aa AA seqDB search
MSRLAGLFDSCRAEGRSGLIGYLPTGFPDVDTSIQAMVALVESGCDIVEVGVAYSDPGMD
GPVIAAATEVALRGGVRVHDAFRAVEAISNAGGKAVVMTYWNPVLRKGVDTFARDLASAG
GLGLITPDLIPDEADDWFAASEAHDLDRIFLVAPSSTPERLAETVQASRGFVYAASTMGV
TGARDAVSNAAPELVARVKAISDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALKE
GIPAVRSLTAELADGVRQRITA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctggccgggctgttcgactcctgccgtgccgagggccgttcggggctgatc
ggctatctgcccaccgggtttccggatgtcgacacgtcgatccaggcgatggtcgcgctg
gtcgagtctggctgcgacatcgtcgaggtgggtgtcgcatactcggaccccggcatggac
ggtccggtcatcgcggcggcgaccgaagtcgcgctgcgcggcggcgtccgggtgcacgac
gcgttccgcgctgtcgaggcgatcagcaatgccggcggcaaggcggtcgtaatgacgtac
tggaatccggtgttgcgcaagggagtcgacacgttcgcccgtgacctggcgtcggcaggc
gggctcgggttgatcacgccggacctgatccccgacgaggccgacgactggttcgccgcc
tccgaggcacacgatctggaccggatcttcctggtggccccgtcgtcgacgccggagcgt
ctcgccgagacggtgcaggcgtcccgcggattcgtctacgcggcgtccacgatgggcgtc
accggcgcacgcgacgcggtgtccaacgccgcgccggagctcgtcgcgcgcgtgaaggcc
atctcggacatcccggtcggtgtggggctgggcgtgcgctcccgtgagcaggcagcagag
atcggcgcctacgccgacggcgtcatcgtcggatcggcactggtgtcggcgctcaaggag
ggcatccccgcggtgcgctcgctgacagcggaacttgcagacggcgtacggcagaggatc
actgcgtga

DBGET integrated database retrieval system