KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3599Help
Entry
Mflv_3599         CDS       T00498                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00260  Glycine, serine and threonine metabolism
mgi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01130  Biosynthesis of antibiotics
mgi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mflv_3599
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mflv_3599
Enzymes [BR:mgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mflv_3599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: ABP46073
UniProt: A4T9P4
Position
complement(3842298..3843560)
Genome map
AA seq 420 aa AA seqDB search
MVDFAGPDLPRASAAVAEPTPHDPDARGHFGAYGGRLVPEALMAVIEEVTAAYEKARSDQ
TFLDELDRLQRHYTGRPSPLYEAERLSEHAGGARIFLKREDLNHTGSHKINNVLGQALLA
KQMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGASVVS
VESGSKTLKDAINETFRDWVADADNTYYCFGTAAGPHPFPMMVRDFQRVIGMEARAQMLD
QAGRLPDAVVACVGGGSNAIGIFHAFIDDPGVDLIGYEAAGDGVETGRHAATFTGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDVGRARYLPITDSEAMDALSL
LSRTEGIIPAIESAHAIAGALKLGVERGPGTVILVNLSGRGDKDVETAAKWFGLMEDGAR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgatttcgccggccccgacctgccgcgcgccagcgccgcggtcgctgagcccacc
ccgcacgaccccgacgcccgaggccacttcggcgcctacggcggacggttggttcccgag
gcgctgatggcggttatcgaggaggtgaccgcggcgtatgagaaggcacgcagcgaccag
acgttcctcgatgaactcgaccgcctgcaacgccactacaccggccgcccgtcaccgctc
tacgaagccgaacggctcagcgagcacgcgggcggtgcgcggatcttcctgaaacgagaa
gacctcaaccacaccggatctcacaagatcaacaacgtgctggggcaggcgctgctggcc
aagcagatgggcaagacccgggtcatcgccgagaccggtgccgggcagcacggcgtggcg
accgcgaccgcgtgcgcgctgctgggcctggaatgtgtcatctacatgggcgcggtggac
accgcccgacaggcgctgaacgtggccaggatgcgtctgctcggagcctcggtggtgtcc
gtcgagtcgggctcgaagacgttgaaggacgccatcaacgagacgttccgggactgggtc
gccgacgccgacaacacgtactactgcttcggcacggcggccggaccgcacccgttcccg
atgatggtgcgcgacttccagcgcgtcatcgggatggaagcccgtgcgcagatgctcgat
caggcgggacgcctgcccgacgccgtcgtcgcctgtgtcggaggcggatcgaacgcgatc
gggatcttccacgcgttcatcgacgacccgggcgtcgacctgatcgggtacgaggcggcg
ggcgacggcgtcgaaaccggacgtcacgccgcgacgttcaccggcggatcgcccggcgcg
ttccagggctcgttctcgtacctgttgcaggacgaggacggacagaccatcgaatcccat
tcgatctcagcaggtttggactatcccggtgtcgggccggagcacgcgctgctcaaggac
gtgggtcgtgcgcggtatcttccgatcaccgacagcgaggcgatggacgcgctgtcgctg
ttgagccgtaccgaaggcatcatcccggccatcgagtccgcgcatgcgatcgccggagcg
ctcaagctcggcgtcgagcggggccccggaacggtgatcttggtcaacctgtctggtcgg
ggcgacaaggacgtcgagacggcggcgaagtggttcggtctgatggaggacggggcacga
tga

DBGET integrated database retrieval system