KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3747Help
Entry
Mflv_3747         CDS       T00498                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00240  Pyrimidine metabolism
mgi00250  Alanine, aspartate and glutamate metabolism
mgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mflv_3747
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mflv_3747
Enzymes [BR:mgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mflv_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431
Motif
Other DBs
NCBI-ProteinID: ABP46219
UniProt: A4TBY0
Position
complement(3998477..3999424)
Genome map
AA seq 315 aa AA seqDB search
MKHLLTAADLSRDDATAILDNADRFREALVGREVKKLPTLRGRTIITMFYENSTRTRVSF
EVAGKWMSADVINVSASGSSVAKGESLRDTALTLRAAGADALIIRHPASGAPQQLAAWTL
DEHGGPSVINAGDGTHEHPTQALLDALTIRQRLGSVEGKRVVIVGDVLHSRVARSNVALL
HTLGAEVVLVAPPTLLPVGVTEWPVTVSHELDAELPLADAVLMLRVQAERMNGGFFPSSR
EYSVRYGLSEKRQSTLADHAVVLHPGPMLRGMEIAYSVADSSQSAVLQQVSNGVHVRMAV
LFHLLVGSEEEAISA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcatctgctgaccgcggcagacctcagccgcgacgacgccaccgcgatcctggac
aacgccgaccgattccgcgaggccctggtcggccgcgaggtcaagaagctgcccacgttg
cggggccgcaccatcatcacgatgttctacgagaactccacccgcacccgggtgtcgttc
gaggtggccggcaagtggatgagcgccgacgtcatcaacgtcagcgcctcgggatcctct
gtggccaagggggagtcgttgcgcgacaccgccctgaccctgcgcgccgccggcgccgac
gcgctgatcatccgtcatcccgcctcgggggcgccccagcagctggcggcctggacgctc
gacgagcacggcggaccgtcggtcatcaatgccggcgacggcacccacgaacacccgacc
caggctctgctcgacgcgctgacgatccgccagcggctcggctctgtcgaggggaaacgg
gtcgtgatcgtcggcgacgtgctgcacagccgggtcgcccggtccaacgtggcgctgctg
cacacgctgggcgcggaggtggtcctggtcgcacctcccaccctgctgccggtcggtgtg
acggaatggccggtcaccgtgtcccacgagctcgacgccgaactgcccctcgccgacgcg
gtactgatgctgcgcgtgcaggccgaacgcatgaacggcggcttcttcccgtcgtcgcgg
gagtactccgtgcgctacggattgtccgagaagcggcagtcgaccctggccgaccatgcc
gtcgtgctgcaccccggcccgatgctgcgcgggatggagatcgcgtactcggtggccgac
tcgtcgcaatcggctgttctgcaacaggtttccaacggtgttcatgtccggatggcggtg
ttgttccacctgctcgtcgggtcggaagaggaagcgatcagcgcatga

DBGET integrated database retrieval system