KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4066Help
Entry
Mflv_4066         CDS       T00498                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00250  Alanine, aspartate and glutamate metabolism
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mflv_4066
Enzymes [BR:mgi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mflv_4066
Peptidases [BR:mgi01002]
 Cysteine Peptidases
  Family C44
   Mflv_4066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ABP46536
UniProt: A4TCC9
Position
4318938..4320743
Genome map
AA seq 601 aa AA seqDB search
MCGATGEVRLDGTSPDVRAVAAMAEVMVPRGPDAAGAWSQGRVALGHRRLKIIDLTEAGA
QPMVDSDLGLTIAWNGCIYNYEELRDELAGHGYRFFSHSDTEVLLKGYHHWGDRFVDHLK
GMFAFAIVERDSGRVLLGRDRLGIKPLYLTLTPDRIRFASSLPALLAGGGVDTRIDPVAL
HHYMTFHSVVPAPHTILRGVTKLPPASLMAIEPDGRITTTTYWEPDFTRHADRADWSEKD
WEEATLDSLRTAVKRRLVADVPVGCLLSGGVDSSLIVGLLAEAGQHGLATFSIGFESVNG
VAGDEFKYSDIIAQRFGTDHHQIRIDTARMLPALDGAIGAMSEPMVSHDCVAFYLLSQEV
AKHVKVVQSGQGADEVFAGYHWYPPMGEPAAASLEGSVASYRGAFFDRDRAGYADIVAPG
YLTGDDPSELFVTEHFARAGAETGVDRALRLDTTVMLVDDPVKRVDNMTMAWGLEGRVPF
LDHELVELAATCPPQYKTAHEGKGVLKQAARQVIPSEVIDRPKGYFPVPALTHLEGPYLE
LVRDALYAPVAKERGLFRPDAVERLLADPNGRLTPLRGNELWQIALLELWLQRHGITGAA
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggagccaccggcgaggtaagactcgacggcacaagcccagatgtccgagctgtc
gcagccatggccgaggtcatggtcccccgcggtcccgacgccgccggcgcctggtcgcag
ggccgggtggccctgggccaccggcgcctcaagatcatcgatctcaccgaggcgggcgcc
cagccgatggtcgactccgatctcggtctgacgatcgcctggaacggctgcatctacaac
tacgaggagttgcgcgacgagctcgccggtcacggctaccgcttcttctcccacagcgac
accgaggtgctgctgaagggttatcaccactggggtgaccgcttcgtcgatcacctcaag
ggcatgttcgccttcgcgatcgtggaacgtgacagtggacgcgtgctgctgggccgcgac
cgcctcggcatcaagcccctctacctcaccctgaccccggaccggatccggttcgcgtcg
tcgctgcccgcgctgctcgccggcggcggtgtcgacacccgcatcgatcccgtcgcactg
caccactacatgacgttccattccgtggtgcccgcgccgcacaccatcctgcgcggtgtc
acgaagcttccgccggcgtcgctgatggcgatcgagccggatggcaggatcacgacgacc
acctactgggagcccgacttcacccggcatgccgaccgggccgactggtccgagaaggac
tgggaggaagcgactctcgactcgctgcggaccgccgtgaagcgacgcctggtcgccgac
gtccccgtcggctgcctgctctcgggcggggtcgactccagcctgatcgtcggtctgctc
gccgaggccggccagcacggcctggcgaccttctcgatcggcttcgagtcggtcaacggc
gtcgccggcgacgagttcaagtactccgacatcatcgcccaacgcttcggcaccgaccat
caccagatccgcatcgacaccgcccgcatgctgcccgccctcgacggtgcgatcggcgcg
atgagcgagccgatggtcagccacgactgcgtggcgttctatctgctcagccaggaggtc
gccaagcacgtcaaggtcgtgcagtcgggtcagggcgccgacgaggtgttcgccggctac
cactggtatccgccgatgggcgagccggcggccgcatcgctggaaggctcggtcgccagc
taccgcggggcgttcttcgaccgcgaccgggcgggttacgccgacatcgtggcgccgggc
tacctcaccggcgacgacccgagcgagttgttcgtcaccgagcacttcgcccgggccggt
gccgagaccggggtcgaccgcgcgctgcgtctggacaccacggtgatgttggtcgacgac
ccggtcaagcgcgtggacaacatgacgatggcgtggggcctggagggccgcgtcccgttc
ctcgaccacgagctcgtcgagctcgccgccacctgcccgccgcagtacaagactgcccac
gagggcaagggcgtcctcaaacaggctgcgcgccaggtcattccgtccgaggtcatcgac
cggccgaagggctatttcccggtcccggcgctgacgcacctggagggtccgtatctggag
ctggtccgtgacgcgctctacgcgccggtggccaaggaacgcggcctgttccggccggac
gcggtcgagcggctgctggccgatcccaacggcaggctgacgccgttgcggggcaacgaa
ctctggcagatcgcgctgctggaactgtggttgcagcgccacggcatcaccggcgccgcc
gcatga

DBGET integrated database retrieval system