KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4083Help
Entry
Mflv_4083         CDS       T00498                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00900  Terpenoid backbone biosynthesis
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01130  Biosynthesis of antibiotics
Module
mgi_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mflv_4083
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mflv_4083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABP46553
UniProt: A4TCB7
Position
complement(4336141..4337304)
Genome map
AA seq 387 aa AA seqDB search
MNERLRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNRDLLARQRAETGVTNIAV
ADEAAAAALGEVTYSGPDAVTRLVEATEADVVLNGLVGALGLKPTLAALATGARLALANK
ESLVAGGPLVQKAAAPGQIVPVDSEHSALAQCLRGGSADEVATLVLTASGGPFRGWSVDR
LEDVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGIDYDRIDVVVHPQSIVH
SMVTFTDGSTLAQASPPDMKLPIALALGWPARVAGAAAACDFSTASRWDFEPLDDEVFPA
VALAREAGKTGGCMTAIYNAANEEAAEAFLAGRIRFPAIVRTVAEVLRAADQWAAEPATV
DDVLDAQNWARDRARSAVERESAGSRS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagcggcttcgcgtactgatcctcggcagcaccggctcgatcggaacccaggcg
ctcgaggtgatcgccgccaatcccgaccggttcgaggtggtcgggctggctgccggcggc
ggcaaccgcgacctgctggccaggcaacgcgccgagaccggagtcaccaacatcgccgtc
gccgacgaggccgcggccgccgcgctgggtgaggtcacctactccggacccgacgcggtg
acccggctggtcgaagccaccgaggctgatgtcgtgctcaacggactcgtcggagcgctc
ggcctcaagcccacgctcgccgcgctggccaccggggcccgcctggcgctggccaacaag
gagtcgctggtcgccggcgggcccctggtgcagaaagccgccgcacccgggcagatcgtc
ccggtggactccgagcattccgcgctcgcgcagtgcctgcgcggcggtagcgccgacgag
gtcgccacactcgtcctgaccgcatccgggggtccgttccgcgggtggtcggtggaccgg
ctcgaggacgtcacgcccgagcaggccggcgcccacccgacgtggtcgatggggccaatg
aacacgctgaactcggcatcgctggtcaacaagggtctggagctgatcgagacccacctg
ctgttcggcatcgactacgaccgcatcgacgtcgtcgtgcatccgcagtcgatcgtgcac
tcgatggtgaccttcaccgacggatccaccctggcccaagccagcccgcccgacatgaag
ttgccgatcgcgctggcgctgggctggcccgcacgtgtcgccggcgccgccgcggcctgc
gacttcagcaccgcttcgcgctgggacttcgagccgctcgacgacgaggtcttcccggcg
gtggccctggcccgcgaggccggcaagaccgggggatgcatgaccgcgatctacaacgcg
gcaaacgaggaagcggccgaggcgttcctcgcgggcaggatcaggttccccgcgatcgtg
cgcaccgtcgccgaagtgctgcgcgctgccgaccagtgggccgccgaaccagctaccgtg
gacgacgtactcgacgcacagaactgggcccgtgaccgggcgcggagcgccgtcgagcgg
gaatccgcaggtagcagaagttag

DBGET integrated database retrieval system