KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_4356Help
Entry
Mflv_4356         CDS       T00498                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00071  Fatty acid degradation
mgi00072  Synthesis and degradation of ketone bodies
mgi00280  Valine, leucine and isoleucine degradation
mgi00310  Lysine degradation
mgi00362  Benzoate degradation
mgi00380  Tryptophan metabolism
mgi00620  Pyruvate metabolism
mgi00630  Glyoxylate and dicarboxylate metabolism
mgi00640  Propanoate metabolism
mgi00650  Butanoate metabolism
mgi00900  Terpenoid backbone biosynthesis
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01130  Biosynthesis of antibiotics
mgi01200  Carbon metabolism
mgi01212  Fatty acid metabolism
mgi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mflv_4356
   00630 Glyoxylate and dicarboxylate metabolism
    Mflv_4356
   00640 Propanoate metabolism
    Mflv_4356
   00650 Butanoate metabolism
    Mflv_4356
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mflv_4356
   00072 Synthesis and degradation of ketone bodies
    Mflv_4356
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mflv_4356
   00310 Lysine degradation
    Mflv_4356
   00380 Tryptophan metabolism
    Mflv_4356
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mflv_4356
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mflv_4356
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mflv_4356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgi04147]
    Mflv_4356
Enzymes [BR:mgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mflv_4356
Exosome [BR:mgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mflv_4356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABP46825
UniProt: A4TDP0
Position
complement(4632409..4633584)
Genome map
AA seq 391 aa AA seqDB search
MSTPVIVGAARTAIGRSFKGTLVNTPPETLITTVLPEVIRRSGVDPADIDDIIFAESHYG
GGDLARYAADAIGLQHVPGQSVNRHCAGSLTAIGNAAAQIGSGMERVMIAGGVQSLSMTP
LVNWRIPGPELKFEERWMPPTHVETPDAPTKDMSITVGWNTAQAAGITREDMDAWAARSH
QRAVAAQDDGKFLDEIVPLKVEQFDGSVIDFSVDEQPRRDTSVEKLAGLKVLHPEIEGFS
ITAGNASGTNDAAAGVALVEADYAAANGLTVMAKVRSWGAVGVAPRDTGLGGVKVIGRVL
DKAGLKPSDVTLWEINEAFASVPIAAVREYGIDEELVNFSGSGCSLGHPIAASGARMITT
LIYELQRRGGGIGVAAMCAGGGQGGGVVIEV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacccgtcatcgtcggtgctgccaggacggccatcggccgctcgttcaagggc
acactggtcaacaccccgccggaaacgctgatcacgacggtgctccccgaggtcatccgc
cgttccggcgtcgacccggccgacatcgacgacatcatcttcgcggaatcgcattacggc
ggtggtgatctggcgcgctacgccgccgacgccatcggactgcagcatgttcccggccag
tcggtgaaccggcactgtgcaggcagcctgaccgcgatcggcaacgccgccgcgcagatc
ggctccgggatggagcgggtcatgatcgccggaggggtgcagtcgctgtcgatgaccccg
ctcgtcaactggcggatcccgggcccggagttgaagttcgaagagcgctggatgccgccc
actcacgtcgagaccccggacgcccccaccaaggacatgtcgatcaccgtcggctggaac
accgcgcaggccgcgggcatcacccgtgaggacatggacgcgtgggccgcccggtcgcac
cagcgcgccgtggccgcccaggacgacgggaagttcctcgacgagatcgtgccgctgaag
gtcgaacagttcgacggttcggtgatcgacttcagcgtcgacgagcaaccgcgtcgtgac
acctccgtcgagaagttggccggcctcaaggtgctgcaccccgagatcgagggcttctcc
atcaccgccggcaatgcgagcggcaccaacgacgcggctgccggtgtggcgctggtcgag
gctgattacgccgccgccaacggactcaccgtgatggccaaggtccggtcctggggtgcg
gtgggcgtggccccccgcgacaccggcctgggcggcgtcaaggtcatcggccgcgtgctg
gacaaggcgggcctcaagccgtccgacgtgaccctgtgggagatcaacgaggcgttcgcg
tccgtgccgatcgccgcggtccgcgaatacggcatcgacgaggaactggtcaacttctcg
ggcagcggctgcagcctcggacatccgatcgcggcgtccggcgcccggatgatcaccacc
ctgatctacgaattgcagcgccgcggtggtggcatcggtgtcgccgcgatgtgcgccggt
ggcggccagggcggcggcgtcgtcatcgaggtgtag

DBGET integrated database retrieval system