KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_4367Help
Entry
Mflv_4367         CDS       T00498                                 

Definition
(GenBank) Butyryl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00071  Fatty acid degradation
mgi00280  Valine, leucine and isoleucine degradation
mgi00410  beta-Alanine metabolism
mgi00640  Propanoate metabolism
mgi00650  Butanoate metabolism
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01130  Biosynthesis of antibiotics
mgi01200  Carbon metabolism
mgi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mflv_4367
   00650 Butanoate metabolism
    Mflv_4367
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mflv_4367
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mflv_4367
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mflv_4367
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Mflv_4367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: ABP46836
UniProt: A4TDN7
Position
complement(4644208..4645401)
Genome map
AA seq 397 aa AA seqDB search
MSRLAQTLGLTEFQTEIVSTVRQFVDKEVIPTAQELEHADTYPQAIVDAMREMGLFGLMI
PEEYGGLGESLLTYALCVEELARGWMSVSGVINTHFIVAYMIRQHGTDAQKSHYLPRMAT
GETRGAFSMSEPELGSDVAAIRTRAKNNGDGTYTIDGQKMWLTNGGSSTLVATLVRTDEG
ADKPHRNLTAFLIEKPTGFGEVAPGLTIPGKLDKLGYKGIDTTELIFDGYRADAGDILGE
APGQGFFQMMDGVEVGRVNVSARACGVGIRAFELAVKYAQQRSTFGKPIAEHQAIAFQLA
EMATKVEAAHLMMVNAARHKDSGERNDVAAGMAKYFASEVCAEVTQQSFRIHGGYGYSKE
YEIERLMRDAPFLLIGEGTSEIQKNIISKRLLADYRV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggttggcgcagaccctggggctgacggagttccagaccgagatcgtctccacc
gtgcggcaattcgtcgacaaagaggtgatcccgaccgcccaggaactggagcacgccgac
acctatccgcaggccatcgtcgacgcgatgcgcgagatgggactgttcgggttgatgatc
cccgaggagtacggcgggctgggggagtcgctgctcacctacgcgctgtgcgtcgaggag
ctcgcccgtgggtggatgagtgtgtccggagtgatcaacacgcacttcatcgtcgcctac
atgatccgccagcacggcaccgacgcacagaagagtcactacctgccgcgcatggccacg
ggcgagacgcgtggggcgttctcgatgtcggaacccgaactcggatccgatgtcgcggcg
atccggacccgcgcgaagaacaacggcgacggtacctacaccatcgacggccagaagatg
tggctgaccaacggcggcagctcgacgctggtggcgacgctggtccgcaccgacgagggc
gccgacaagccgcaccgcaatctgacggcgttcctgatcgaaaagcccaccggtttcggg
gaagtcgcacccggattgaccatcccgggcaagctcgacaagctcggctacaagggcatc
gacaccaccgagctgatcttcgacggctatcgggccgacgccggcgacatcctgggcgag
gcgccggggcagggtttcttccagatgatggacggtgtcgaggtcggccgggtcaacgtc
tccgcgcgcgcctgcggggtcgggatccgggcgttcgagctggccgtgaaatatgcccag
cagcgcagcaccttcggcaaacccatcgccgagcatcaggcgatcgccttccagttggcc
gagatggcaaccaaagtcgaggcggcacatctgatgatggtcaacgccgcgcggcacaag
gactccggcgagcggaacgacgtcgcggcgggcatggcgaagtacttcgccagcgaggtc
tgcgccgaggtgacccagcagagcttccggatccacggcgggtacgggtactccaaggag
tacgagatcgagcgcctgatgcgcgatgcacccttcctgctgatcggtgagggcaccagc
gagatccagaagaacatcatcagcaagcggttgctggcggactaccgggtctag

DBGET integrated database retrieval system