KEGG   Mucilaginibacter ginsenosidivorans: FRZ54_01030Help
Entry
FRZ54_01030       CDS       T06123                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
mgin  Mucilaginibacter ginsenosidivorans
Pathway
mgin00520  Amino sugar and nucleotide sugar metabolism
mgin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FRZ54_01030 (nagA)
Enzymes [BR:mgin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     FRZ54_01030 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: QEC61222
UniProt: A0A5B8UQQ9
Position
complement(232733..233845)
Genome map
AA seq 370 aa AA seqDB search
MINALHNLRLISEGQITQGKAVLFDGNTIVDIVDEPAIPADAIKTDLTGNFLAPGFLDLQ
LYGSGGRLLSIDTDEATLLQMENDLLDQGTIGFFPTISTNTNEVIEQTIQVCRSYRDKRR
GNFLGLHLEGPFLNPVRRGAHNKDFIQKASLELVRKWIEMGDGVITMMTIAPELQDQEVI
DYMHSAGIILSSGHSNATYAEGKAFLNKPIPAVTHIYNAMPQMHHRDPGYIPAIFEERPY
TSIVPDGIHVDFVMARLAKRELGDKLFFITDSVTESHHGPYQHRFTGDRYVLASDGTLSG
SCLTMLKCVENGVKHFEISLPESVNMASLYPAQLAKLNKGKIAAGFDADFTVFNDGFELR
GTFMAGKRIN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgataaacgcactccacaatctccggttaatatctgaagggcagataacccagggtaaa
gctgttttatttgatggaaatactatcgttgacatcgttgatgaaccggccataccggct
gatgcaattaaaacagaccttacaggaaattttcttgcgcccggattcctcgaccttcaa
ttatacggcagtggcggccggttacttagtatcgataccgacgaggcaacgctgttgcag
atggagaacgatctgctggaccagggaacaatagggtttttcccgaccatctcgaccaat
acaaacgaggttatcgaacagacaatacaggtttgcaggtcatatcgtgataaacgcagg
ggcaactttttagggctgcacctggagggtcctttcctgaacccggttcgtcgtggtgcg
cataataaggatttcatccaaaaagcatctttggaactggtgcgaaaatggatcgaaatg
ggcgatggagttatcaccatgatgaccattgcgccggaattgcaggaccaggaggttata
gactatatgcatagtgccggcatcattttgtcatcgggacatagtaatgctacttatgca
gagggtaaggcgttcctgaacaaaccgataccggcggtaacgcatatctataatgcaatg
ccccagatgcaccaccgggacccgggttatattcccgccatatttgaagaaagaccctac
accagcattgttccggatggtattcacgtcgatttcgtaatggcccggttggccaaacga
gagttgggtgacaagcttttcttcataacagactcggttaccgaaagccatcacgggcca
tatcagcaccgcttcaccggcgacaggtatgtattggccagcgacggtaccttatcgggt
tcatgccttactatgttgaaatgcgtagagaacggcgtaaagcattttgaaataagtttg
cccgaatccgtcaatatggcctcgctttaccctgctcaactggctaaactgaacaaaggg
aagatagctgccgggtttgatgccgattttacggtatttaacgacggctttgaattgaga
ggaacatttatggcaggcaagcgcataaactaa

DBGET integrated database retrieval system