KEGG   Malassezia globosa: MGL_0058Help
Entry
MGL_0058          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mgl  Malassezia globosa
Pathway
mgl03040  Spliceosome
mgl04141  Protein processing in endoplasmic reticulum
mgl04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MGL_0058
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MGL_0058
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MGL_0058
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgl01009]
    MGL_0058
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mgl03041]
    MGL_0058
   03009 Ribosome biogenesis [BR:mgl03009]
    MGL_0058
   03110 Chaperones and folding catalysts [BR:mgl03110]
    MGL_0058
   04131 Membrane trafficking [BR:mgl04131]
    MGL_0058
   03051 Proteasome [BR:mgl03051]
    MGL_0058
   03029 Mitochondrial biogenesis [BR:mgl03029]
    MGL_0058
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgl04147]
    MGL_0058
Protein phosphatases and associated proteins [BR:mgl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MGL_0058
Spliceosome [BR:mgl03041]
 Complex B
  Other components
   Prp19 complex
    MGL_0058
 Complex C
   Prp19-CDC5 complex
    MGL_0058
Ribosome biogenesis [BR:mgl03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    MGL_0058
Chaperones and folding catalysts [BR:mgl03110]
 Heat shock proteins
  HSP70 / DNAK
   MGL_0058
Membrane trafficking [BR:mgl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    MGL_0058
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    MGL_0058
Proteasome [BR:mgl03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    MGL_0058
Mitochondrial biogenesis [BR:mgl03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    MGL_0058
Exosome [BR:mgl04147]
 Exosomal proteins
  Proteins found in most exosomes
   MGL_0058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 5856589
NCBI-ProteinID: XP_001732283
UniProt: A8PRI2
AA seq 643 aa AA seqDB search
MTKAVGIDLGTTYSCVAVWQNDRVEVIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
PHNTVFDAKRLIGRKFADTEVQSDMKHWPFAVVDRSGKPAIKVEYKGEEKVFTPEEISSM
VLLKMRETAEAYLGSDVKDAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIA
YGLDKKDDREKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFV
QEFKRKNKKDLTSNARALRRLRTASERAKRTLSSAAQTTIEIDSLFEGIDFYTSITRARF
EELCGDLFSHTIDPVEKVLRDSKIDKGSVHEVVLVGGSTRIPRVQKLLRDFFNGREPNKS
INPDEAVAYGAAVQAAILTGDTSEKTQDLLLLDVAPLSMGIETAGGVFTPLIKRNTTVPT
KKSEVFSTYADNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDA
NAILNVSAADKTTGRSEKITITNDKGRLSKEEIERMVADAEKYKAEDDAAAERIKAKNGL
ESYAYNLRNSLNEEAFASKLDASDKDSLKKAIDETIEWLDNTQEGSIDEYQDKQKELEGI
ANPIMQKAYSAAGGAGGFPGGGAAPGGGATGGGDEGPQVEEID
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagctgtcggtattgatttgggtaccacctattcttgtgtggctgtgtggcag
aacgaccgtgtcgaggtcattgccaacgaccagggtaaccgcacgacaccttcgtacgtt
gcctttacagacaccgagcgtctcatcggtgatgccgccaagaaccaggtggctatgaac
ccccacaacactgttttcgacgccaagcgactgatcggtcgcaagtttgccgacacggag
gtccagtcggacatgaagcactggccattcgctgtcgttgaccgatcgggcaagcctgct
atcaaggttgaatacaagggtgaggagaaggtcttcacacccgaggagatctcatcgatg
gttctccttaagatgcgcgagaccgctgaagcataccttggctcggacgttaaggacgct
gttgtgactgtgcctgcctacttcaacgactcgcagcgccaggccaccaaggacgctggt
gtcattgctggcctgaatgtcatgcgtatcatcaacgagccaacggctgctgccattgca
tacggtctcgacaagaaggacgacagggagaagaatgtcctcatcttcgacttgggtggt
ggtactttcgatgtgtccctcctgacgattgaggagggcattttcgaggtcaaggccacc
gctggtgacacgcaccttggtggtgaagactttgacaaccgtcttgtgaaccactttgtg
caggagttcaagcgcaagaacaagaaggacctcacctcaaatgcccgtgctctgcgtcgc
ttgcgtactgcctcggagcgcgccaagcgcaccctctcgtcggctgctcaaaccacgatt
gagattgactcgctgtttgagggtatcgacttctacacttctatcacccgtgcccgcttc
gaggaactgtgtggtgaccttttctcgcacacaattgaccctgttgaaaaggtcctgcgc
gactcgaagattgacaagggctcggttcacgaggttgttctggtcggtggttcgacccgt
attccacgtgtgcagaagctgctccgcgacttcttcaatggccgcgagccgaacaagtcg
atcaacccagacgaggctgtggcttacggtgccgccgtccaggctgccattctgacgggt
gacacgtccgagaagacgcaggacctgcttcttctcgacgttgcccctctctctatgggt
attgaaacggctggtggtgtctttacccctcttatcaagcgtaacacgaccgtgccaacc
aagaagtcggaggtcttctcgacttacgcggacaaccagcctggtgtgttgatccaggtg
tacgagggtgagcgtgcccgcactaaggacaacaacctgctgggcaagttcgagctctcg
ggtatcccaccagctcctcgtggtgtgccgcagatcgaagtcactttcgatgttgacgct
aacgccattctgaacgtgtccgctgccgacaagacgactggtcgctcagagaagatcacc
attacgaacgacaagggacgtctttcgaaggaggagatcgagcgtatggtggctgatgct
gagaagtacaaggctgaggatgacgctgccgctgagcgtatcaaggcaaagaacggcctc
gagtcgtacgcttacaacctgcgtaactcgttgaacgaggaggccttcgcgagcaagctc
gatgcctcggacaaggactctcttaagaaggccattgacgagaccattgagtggcttgat
aacacgcaagaaggctcgattgacgagtaccaggacaagcagaaggagctcgagggcatt
gccaacccgatcatgcagaaggcctacagtgccgctggtggcgcaggtggcttccctggt
ggtggtgctgctcctggtggtggagctactggtggtggcgacgagggcccacaggtggag
gagattgactaa

DBGET integrated database retrieval system