KEGG   Malassezia globosa: MGL_0154Help
Entry
MGL_0154          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
mgl  Malassezia globosa
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mgl01002]
    MGL_0154
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mgl03110]
    MGL_0154
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     MGL_0154
Peptidases and inhibitors [BR:mgl01002]
 Serine peptidases
  Family S8: subtilisin family
   MGL_0154
Chaperones and folding catalysts [BR:mgl03110]
 Intramolecular chaperones
  Subtilisin family
   MGL_0154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII DUF3829
Motif
Other DBs
NCBI-GeneID: 5856685
NCBI-ProteinID: XP_001732379
UniProt: A8PRY3
AA seq 1270 aa AA seqDB search
MCTKSATYGVADTFPKHGLLPKQATNSRSRQRFPDYDGRNVRVAVLDTGVDPAALGLDGP
NKVVDIIDCSGAGDVPLQQVEAQARTDDSAILELESPTTKRKLLVDAAWPNPSGVWKVGT
KRAYDLWPTGLVERRTKERKKAFDVSHAALLQRALDELASERASTPSSTSDAKDRDAAAQ
RCEELQARVSVLKDMHKAWKDPGPVLEAVVFHDGMHWRAVVGGAEGDVIDSSKGEPESQH
AMVLDLREKPRLTDYRLEREWAYFGEMDLLTYSVNIMNDGQLLSIVTLSGTHGTHVAGII
GAQTQDPATDGVAPGTEIVSLRIGDARLGSMEQGQALLRAAQALIDTRCDVANMSYGEDG
AFGVEDKGAFAHALHQVIREHGVCFVSSAGNNGPALTTVGQPGGTTSGVLSVGAYVTAGD
MQQAEYALVERGVPSNVTTWCSRGPTADGAAGVSIYAPGAAITSICRYALQSTQLMNGTS
MSSPNAAGAVALLVGACKPEGITPTPFRIFRAIQESGADVRDPQGIKFLDVEKAWDYILA
HRDDPYADADMRVRVTRAGKPLNVVDQRGVYLREVEETHRTTQFLVTVQPTFRSGETQRA
YKLDLKTSLSATQPWVHVPEFLALGGNGRTFEIRIAADALPPGLHTAQVIAHDTERNGAV
VFDVPITVAKPVVLPTATYAYPRVRLASGDIHREFVQVPMGATWADVRVRSVKHEAPGTS
VRFWLHMLQLVPQRRLSKVEQHFVLALNENEPISKRVPVYGGMTLEVCAAQFWSSKAGFE
LELDVEFHGLDTVPKLVAHSGDAHTKVDVTSLVRCEDLKPSASLDTRRTYVRPSKYVLRP
LREPRDRQPSGHQLHELVLEYPVIVKDACALTWRLPLSGYLYDASVTLLTQLLDVNQAQV
AFGDVYAKPVDVAKGEYTLRVQALHESAAVLDHLHAMPLSLEQKLKKDISLDVYRDHVDL
QSHVRPAKEALKLHKGERAVLCIDTALHGERWPSDGVSVHTGDVLCGTLTLGGSSDAKAA
KVPLDVVVGLPPPSKSAATAAPNDPQREPASLPTLLAGLVCKVPESDKSAFVEQLVQKYP
TDLSVRVAALDACDAEDADASLRAAQGVRECIDETALRLWLGAKQPPTAEQTHEQKATAK
TMQTHKAALVNALVREAKAHAQRDPSSQVCTDAIMHARQYVDDSDARLRAMHTNLLTAWH
QRNERYGYALQGVRKQLDDLGRGTSDTRDDLRRAHDLQCELLEHLRWDVWRHYETRWAWL
RRPSTGAAPF
NT seq 3813 nt NT seq  +upstreamnt  +downstreamnt
atgtgcacgaagagtgcgacgtatggcgttgctgacacatttccgaagcatggattgctt
ccgaagcaggctacaaatagtcgttcccggcagcgctttcctgactatgatggacgcaac
gtacgtgtggccgttctcgacacgggcgtcgaccctgcggcattgggtctggacgggccc
aacaaggtcgtggatattatcgactgctcgggcgcaggagatgttccgttgcaacaagtt
gaggcacaggcccgcactgatgatagcgctatcctggagctcgagtcgcccacgacaaaa
cgcaagctccttgtcgatgctgcatggccgaatccatcaggtgtgtggaaggtcggtacc
aagcgtgcgtatgatttgtggccgacagggctcgttgagagacggacgaaggaacgaaag
aaggcgtttgatgtgagccacgcggctctgctgcagcgtgcgctcgacgagctggcgtcg
gaacgcgcttcgactccgtcaagtacgagcgatgcaaaggaccgagatgccgccgctcag
cgctgcgaggagctccaggcacgtgtatcggtgctgaaagacatgcacaaggcatggaaa
gacccaggacccgtcctggaggccgtcgttttccacgacggtatgcactggcgtgctgtc
gtcggcggagcggaaggcgacgtcatcgattcatcgaagggcgagccagagagtcaacat
gcgatggtgctcgatcttcgcgaaaagccgcgtctcactgactaccgtttagagcgcgag
tgggcgtactttggcgaaatggacttgctcacatattcggtgaacatcatgaacgacgga
caactgctctcgatcgttacgctctctggaacgcatggcacgcatgtcgcgggtatcatc
ggtgcgcagacgcaggacccggccacagacggcgtcgctcccggcacagagatcgtgagt
ttgcgtattggcgatgcgcgtcttggcagcatggagcaaggccaggcgctcttgcgcgct
gcccaggcgctgatcgatacacgctgcgatgttgctaatatgtcgtatggtgaagatggc
gcatttggcgtagaagacaagggcgcttttgctcatgcgctgcaccaggtcatccgtgag
cacggcgtgtgttttgtttcgtcagcggggaacaatggccctgcgctcacaaccgtcgga
caaccaggcggcacgacgtctggtgtgttgagtgtgggtgcgtacgtgaccgctggcgac
atgcaacaagcagaatatgcgctggtcgagcgaggtgtgccttcgaatgtcacaacttgg
tgtagtcgcggccctacagccgatggcgccgctggcgtctcgatctatgcacctggtgct
gcgatcacctccatttgccgatatgctttgcagtcgacgcagctgatgaacggcacctcc
atgagtagtcccaacgcggctggggccgtggctctcctcgtcggtgcatgcaagccagaa
ggcatcacgcctacgccattccgcatcttccgtgccatccaagaatcaggcgccgatgtg
cgtgatccacagggcatcaagttcctcgatgtcgaaaaagcctgggactatatcctagcg
catcgcgacgacccgtatgcagacgctgacatgcgtgtgcgagtaacacgtgcaggcaag
cctttgaatgtcgtcgatcagcgcggcgtgtacttgcgcgaggttgaagagacgcatcga
acgacgcagttcctcgtcacggtgcagccgacattccgctctggcgagacgcaacgtgca
tataagctggatctcaaaacctcgctttcagccacccaaccatgggtacatgtgcccgaa
tttcttgcccttggcggcaatggccgtacgttcgagattcggatcgccgcggacgcactg
ccgcccggtttgcatactgcacaggtcattgctcatgataccgagcggaatggtgccgtt
gtctttgatgtgccgatcaccgttgccaagcctgtggtgctgccgacggcaacgtacgca
tacccacgagtgcgactcgcatctggggacatccaccgcgagtttgtgcaggtgccgatg
ggcgccacatgggccgatgtgcgtgtgcggagtgtgaagcacgaggctccaggcacgagc
gtgcgcttctggctgcacatgctgcagcttgtgccgcaacgtcgcctaagcaaggttgag
caacactttgtgcttgcattgaacgaaaatgaacccatcagcaaacgcgtgcctgtgtat
ggtggcatgactcttgaggtgtgcgcagcacagttctggtcgagcaaggctgggtttgag
ctggagctggacgtcgagttccatggcctcgacacggtgcccaagctcgtcgctcactcg
ggggacgcgcacacaaaagtcgacgttaccagcctcgtgcggtgtgaggacttaaagccc
agtgcgtcgctcgacacacgtcgcacatacgtgcggccgtcaaagtatgtgctgcgccct
ctgcgggagccgcgcgatcgtcagccgtcggggcatcagctgcatgaactcgtactggag
taccctgtcattgttaaggatgcttgcgcgctgacgtggcgcttgccgctcagtggctat
ctgtatgatgcaagtgtgacgcttctcacgcaactgctcgatgtgaatcaagctcaggtg
gcattcggcgatgtatatgcgaaaccagtagacgtcgcaaaaggcgagtacactctgcga
gtgcaagcattgcacgagtcggctgctgtgttggaccatctgcatgcaatgcccctctct
ctcgagcagaagcttaagaaagacatttctctcgacgtataccgcgaccatgtcgaccta
caaagccatgtgcgtccggcgaaagaagcactcaagctgcacaagggcgagcgagcagtc
ttgtgcatcgacacagcacttcatggcgagcgctggccaagtgatggcgtcagtgtccat
actggcgatgtgttgtgcggcacgctcacgctgggcggaagtagcgatgcaaaagctgcc
aaggtaccgctggacgtggtcgttggtcttccaccaccatcgaaatcggccgcgactgca
gccccaaatgacccccagcgtgaacctgcgtcactccccacgcttttggccggccttgtc
tgcaaggtacccgagtctgacaagtctgcctttgtcgagcagctggtgcagaagtacccg
accgacttgtccgttcgcgtggctgctctggatgcatgcgatgctgaggacgctgatgca
tctttgcgcgctgctcagggtgtgcgtgaatgcattgatgagacggcattgcgcctgtgg
cttggcgctaagcagccgcccacagctgagcagacgcatgagcagaaagcgacggccaaa
acgatgcaaacgcacaaagctgcgcttgtgaatgcactagtccgcgaggccaaggcccac
gcacagcgtgatccgtcgtcacaggtttgcacggacgcgatcatgcatgcaaggcagtat
gtggacgacagcgatgctcggctcagggcgatgcacacgaatctgcttacggcttggcac
cagcggaatgaacgctatggctatgcactccagggcgtgcggaagcagcttgacgacctc
ggccgcggcacgagcgacactcgcgatgacctgcgccgagcgcacgacttgcaatgtgag
ttgcttgaacacctccgatgggacgtatggcgtcactatgagactcggtgggcgtggcta
cgtcggccgagcacaggcgctgcgcctttttag

DBGET integrated database retrieval system