KEGG   Malassezia globosa: MGL_0360Help
Entry
MGL_0360          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
mgl  Malassezia globosa
Pathway
mgl00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
mgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    MGL_0360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 5856891
NCBI-ProteinID: XP_001732585
UniProt: A8PT33
AA seq 486 aa AA seqDB search
MPGTGGDDAVASGAEIWALMSNVTDMWPRWRVLTSALASVSCASLDGIDDTTTIVPKHSY
FDTQATMLHAYLPSESMCTENMTPLLKLLPCKGGAGLASLIKPHAILSAEFHGVSLHVRR
TRDRAWDVSVRFQAVMRPALLGDTRWTLDKLFRAHLETTCPVARSSEIHVQSESVPEPPV
GAAGSMKSLSESHSGRSSSSNDDFDTTYGADNVDDGFSDLGEEDDDDEVVKPLVYTVPMH
TYMYDARSLDAYGGVLNISFLSKASSPLVRPPPLRASRQLLGYGQERNSVRLTLRNDLTT
ETVHMLYYEHIPWTVLPLLHTLRADVEVDEYDDADGTVRFTDDVSRPFVVNATYKPSKVR
KTMGSLELVLRVPSSSTLTVSYVLRKHMLHYDEHIPDPHRGMDLPPALFMPLGARGRAWS
ETHKHWPVSYVQAPRLYSTPGLLDMILPDFSMPYNVILFYSTFAAMFFGTVLNQMLRRYR
DVYRLK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcacaggcggggacgatgcagttgccagtggcgcagaaatctgggctctcatg
tccaatgtgactgatatgtggccgcgctggcgcgttcttacttctgcgttggccagtgtt
tcgtgtgcgtcgttggatggtatcgatgataccacaacaattgtgccgaagcattcgtac
tttgacactcaggcgactatgttgcatgcttacctaccatcagagagtatgtgcacagaa
aacatgacgcctctactaaagctgcttccgtgcaagggtggtgcagggcttgccagcttg
atcaagcctcacgcgatactgagtgcggagtttcatggcgtctcgctgcatgtgcgtcgc
acccgagaccgtgcatgggatgtatctgttcgctttcaggcagtgatgcggcctgcattg
ctgggtgatacgcgttggacacttgacaagctattcagggcacaccttgagactacatgc
ccagtggctaggtccagcgagattcacgtccagagtgaatcagtacctgaaccgccagtg
ggggcagctggctccatgaagagtcttagcgagtctcacagtggtagaagctcgtctagt
aacgatgattttgataccacctatggtgccgacaatgtggacgacggcttcagcgacctc
ggcgaggaagatgatgacgacgaagtagtcaagcctttggtttacacggtgccgatgcat
acgtatatgtacgatgcgcgctcgcttgatgcgtatggaggagttctgaacatctcgttc
ctatcgaaggcctcaagtcctttggttcgtccgccgccccttcgcgcgtctcggcagctg
ttgggctacggacaagagcggaattccgtgcgtctcacgctacggaatgacttgacaaca
gagaccgtgcatatgttgtactacgagcatataccttggactgtgcttcccttgttgcac
acgttgcgagcagatgtcgaagtggatgaatatgatgatgcggatgggacggtgcggttc
actgatgatgtgagtcggccgtttgttgtgaatgcaacgtacaagccatcgaaagtacgt
aagacgatggggtctcttgagcttgtgctgcgtgtaccttcttccagcacactcacggta
tcgtacgtgctgcggaaacacatgctacattacgatgaacacattcctgatccacatcgc
ggaatggatttgccgcctgcgctgtttatgccgctcggtgctcgcggtcgtgcgtggtct
gagacacacaagcactggccggtgtcctacgtgcaggcgccgcgtctgtactcgacgcca
ggcttgctggatatgatcttgccagacttttccatgccatacaatgtaattcttttctac
tctacatttgctgcaatgtttttcggaacggtgctaaatcaaatgctcagaaggtacaga
gatgtgtatcgcttgaaataa

DBGET integrated database retrieval system