KEGG   Malassezia globosa: MGL_1342Help
Entry
MGL_1342          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mgl  Malassezia globosa
Pathway
mgl00620  Pyruvate metabolism
mgl00630  Glyoxylate and dicarboxylate metabolism
mgl01100  Metabolic pathways
mgl01110  Biosynthesis of secondary metabolites
mgl01200  Carbon metabolism
Module
mgl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGL_1342
   00630 Glyoxylate and dicarboxylate metabolism
    MGL_1342
Enzymes [BR:mgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MGL_1342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 5855466
NCBI-ProteinID: XP_001731159
UniProt: A8PX66
AA seq 533 aa AA seqDB search
MSVEGVRILAPVLGEHASILTPEAIKFLVVLHRSFEGVRQERLKARAARQVELDGGKTLD
FLPQTRHIREDPSWRCAIPSPGLRDRRVEITGPVDRKMVINALNSGAYTYMADFEDSNSP
TWANNLDGQVNLRDAINRRVDFKASNGKEYKLRPANELATLIVRPRGWHLNEESFHVDGK
PMSGGLFDFGLFFFHNGHQLVKNGLGPYFYLPKMESHLEARLWNDVFNLAQDYVNMPRGT
IRGTVLIETITAAFEMEEILYELREHSSGLNCGRWDYIFSFIKRQRYNKSAVLPDRSAVT
MTCPFMQAYVNLLIQTCHKRGAAAIGGMAAQIPIKDDAKANEAAMEKVRADKLREVTAGH
DGTWVAHPALVKIALEIFNKHMLGPNQYHVRREEVRVSALDLLNPNVDGKITEGGARANV
SALLAYCANWVKGNGCVPINHLMEDAATAEISRISLWQWVFHGSSTVDGKPVTPQFIDEI
IASEAAKLTKLDKNAVDLARRYLSQQVRAKEPSEFLTTDLMAHIDNSISQSRI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgaaggagttcgtattcttgcacccgtgcttggcgagcatgcctcgatcctc
acgcctgaggctatcaagtttcttgttgtactgcaccgaagcttcgagggcgtgcgtcaa
gaacgtttgaaggctcgtgctgcacgacaagtcgagcttgatggaggcaaaacgctagac
tttcttcctcagacacgtcatattcgtgaggacccatcatggcgttgtgcgatcccctca
ccagggctgcgcgaccgccgtgtcgaaatcaccggcccagtggaccgaaaaatggtgatt
aatgcgctgaactcgggcgcctacacttacatggctgactttgaagactcgaactcgcca
acttgggctaataaccttgacggccaggttaatctgcgcgatgcaatcaaccgtcgtgtt
gacttcaaggcatcgaacggcaaggagtacaagctacgccccgccaatgagttggcaaca
cttatcgttcgcccccgtggctggcatctgaacgaagaatctttccatgttgacggcaag
cccatgtctggcggtctgttcgacttcggtctgttcttcttccacaacggtcaccagctt
gtgaagaacggtctcggaccctacttctatttgccaaagatggaatcacacttggaggct
cgtttgtggaatgacgtgttcaacctcgctcaggactacgtcaatatgcctcgcggcacc
attcgtggtactgtgttgattgagacaattactgccgcttttgagatggaggaaattctg
tacgagctgcgcgaacattcatccggtcttaattgtggtcgctgggactacatcttttca
ttcatcaaacgccagcgttacaacaagtcagctgtgcttccagaccgctccgcagttacc
atgacgtgcccctttatgcaggcctacgttaacctgttgattcagacgtgccataagcgt
ggtgcggctgctatcggtggtatggctgcccagatccctatcaaggacgacgcaaaggcc
aacgaagccgctatggagaaggtccgtgctgacaagctgcgtgaggtgacagctggccat
gacggaacatgggtggcccaccctgcactggtgaagattgcacttgaaattttcaacaaa
cacatgcttggccccaatcaataccacgtccgtcgggaggaagtgcgcgtgtctgcactt
gacctactcaatcccaacgtggatggcaagattaccgagggcggtgcgcgtgcgaacgtg
tccgctctgctcgcctactgcgcgaattgggtcaaaggcaatggctgtgtgccgatcaat
cacctcatggaggatgccgcgacagctgagatctcgcgtatttcgctgtggcaatgggtc
ttccacggttcaagcactgtagatggtaagccggtgacgccacagtttatcgatgaaatc
attgcctcagaggccgcgaagctgaccaagttggacaagaatgccgtcgatcttgctcgc
cgttacctgtctcagcaggtgcgtgcaaaggagccaagcgagttcttgaccactgacttg
atggcccatatcgacaattcgatctctcaatcgcggatttaa

DBGET integrated database retrieval system