KEGG   Malassezia globosa: MGL_1950Help
Entry
MGL_1950          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mgl  Malassezia globosa
Pathway
mgl00260  Glycine, serine and threonine metabolism
mgl01100  Metabolic pathways
mgl01110  Biosynthesis of secondary metabolites
mgl01130  Biosynthesis of antibiotics
mgl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGL_1950
Enzymes [BR:mgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MGL_1950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 5855258
NCBI-ProteinID: XP_001730951
UniProt: A8PZU3
AA seq 215 aa AA seqDB search
MYRATLKAPVPLYNAEEQQIAETGPPIICAPATPTCKDDQRAYNLVSWNVLSDTVTLPTS
TMRACMASAVCGDEGYKTDEPTKLLERTVAQLAGKEAALFCASGTQANQLAIHAHLARCT
LPSAVICDFRAHIHACEMGGIAYHSRGTTVPLMPRNQHHLTLKDIQTHCESHGSTYATRV
QVISLENTLQGMIFPHDEVQRIATRSCRCGASSIA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcgccaccctcaaggcgccagtgccgctgtataatgcagaagagcagcagatc
gcagagactgggccgccgattatttgtgcgcctgccaccccaacgtgcaaagacgaccag
cgcgcgtacaatctagtttcatggaacgtcctcagcgacacagtgacgttgcccacgagc
actatgcgcgcctgcatggcatcagccgtgtgcggagatgaaggatacaagacagatgag
ccaacgaagctgctcgagcgcaccgtggctcagcttgcaggcaaagaggcggctttgttc
tgtgccagtggcacccaggcgaatcaacttgcgattcatgcccacttggcgagatgcacg
ctacccagcgccgtcatatgtgattttcgagctcatatacacgcatgtgaaatgggcggt
attgcataccattcgcgaggaacaaccgtgccactcatgccgaggaaccaacaccatttg
acgttgaaagacatccagacacactgtgaatcccacgggtctacttatgccacacgagtc
caagtcatatcgctggaaaatacgctacagggcatgattttcccgcacgatgaagtgcag
cggatcgctacgcgttcttgccgctgcggcgcatcaagcattgcatga

DBGET integrated database retrieval system