KEGG   Malassezia globosa: MGL_2351Help
Entry
MGL_2351          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mgl  Malassezia globosa
Pathway
mgl00020  Citrate cycle (TCA cycle)
mgl00640  Propanoate metabolism
mgl01100  Metabolic pathways
mgl01110  Biosynthesis of secondary metabolites
mgl01130  Biosynthesis of antibiotics
mgl01200  Carbon metabolism
Module
mgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MGL_2351
   00640 Propanoate metabolism
    MGL_2351
Enzymes [BR:mgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     MGL_2351
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MGL_2351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 5854862
NCBI-ProteinID: XP_001730555
UniProt: A8Q3B1
AA seq 181 aa AA seqDB search
MVGPNCPGVINPEGCKIGIMPAHIHMPGKIGIVSRSGTLTYEAVNQTTNVGLGQSLCVGI
GGDPYPGSATVDLVKMYLEDDRSEGIVIIGEIGGSMEEDAAEYLEKYNLTRPNPKPVVAF
IAGRTAPPGRRMGHAGAIISGGKGGADSKVSALEKAGAIVADSPAKIGELMLKAMKDAGR
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggtcggccccaactgccctggtgtgatcaacccagagggctgtaagattggtatcatg
cctgcgcatattcatatgccaggcaaaatcggtattgtctcccgctcgggcacgctcacg
tacgaagccgtgaaccaaaccacgaacgtcggtctcggccagtctctttgtgtgggtatt
ggcggtgatccatacccaggctcggctactgtggatcttgtgaaaatgtacctagaggac
gaccgatctgaaggtattgttattattggtgagattggcggtagcatggaggaagacgct
gccgagtaccttgagaagtacaacctcactcggcccaacccgaagcccgtcgttgcattt
attgccggccgtactgctcctccgggccgtcgtatgggccatgctggtgccattatcagt
ggtggtaagggcggtgctgactcgaaggtcagcgctctcgagaaggctggtgcaattgtt
gctgactcgcccgccaaaatcggtgagcttatgctcaaggccatgaaggatgccggtcgg
gcttaa

DBGET integrated database retrieval system