KEGG   Malassezia globosa: MGL_2860Help
Entry
MGL_2860          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
mgl  Malassezia globosa
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgl01009]
    MGL_2860
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     MGL_2860
Protein phosphatases and associated proteins [BR:mgl01009]
 HAD phosphatases
  Other HAD phosphatases
   MGL_2860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD
Motif
Other DBs
NCBI-GeneID: 5854181
NCBI-ProteinID: XP_001729874
UniProt: A8Q663
AA seq 270 aa AA seqDB search
MGELSSSCLGQIRAVLFDMDGLLIDSERIYTEVVNEILKPFGRQQTWDIKAKLMGKPERD
ATLVLLSSLWPPNQEDPEDVKRGFGSDCPFAIDEFLRKRNELLLPAFRNVQPMPGAVRLI
QHLSKHNIPICVATGSRRHNFEIKSGANPNLFEPFNNRVVCGDDEMIGRGKPYPDIFLNA
VKHGLGWQFSDEGRAILEKIRDPGAEFDGKLGGVEGEILVFEDALVRECNGKLTLSFARH
HTNHDHSARGPSWSLGWHEGCEPWRIKARP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggggaattatcatcgtcatgtttaggacaaattcgcgctgtgctgtttgatatggat
ggcctcctgattgacagtgagcgcatctatacagaagtagtaaacgaaatccttaaaccg
tttggtaggcaacaaacatgggacataaaggcaaagctcatgggtaagccggaacgagat
gcgacactcgtactattgtccagtctatggcctcccaaccaagaagacccagaagacgtg
aaacgtggcttcgggtccgactgtccatttgccattgatgagttccttaggaagcgaaac
gaacttctgttaccagccttccgcaacgtccaaccgatgcctggagctgtacgcttgatc
cagcatctttcaaagcacaacattccaatttgtgttgctactggcagtcgtcggcataat
tttgaaatcaaatccggtgcgaatcccaatttatttgaaccatttaacaatcgagtcgtg
tgtggtgatgatgaaatgatcggacgcgggaagccatatcccgatatatttttaaatgct
gttaagcatgggctcggatggcaattctctgatgagggtcgcgctatcttggaaaagatc
cgcgaccctggagctgaatttgatgggaagcttggtggtgtagaaggcgaaattcttgta
tttgaagatgcattagtacgtgaatgcaatggcaaattgaccctctctttcgcccgtcac
catactaaccatgatcactcagcccggggtccaagctggtctctcggctggcatgaaggc
tgcgagccgtggcggatcaaggcccgcccatag

DBGET integrated database retrieval system