KEGG   Malassezia globosa: MGL_2924Help
Entry
MGL_2924          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
mgl  Malassezia globosa
Pathway
mgl00330  Arginine and proline metabolism
mgl01100  Metabolic pathways
mgl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MGL_2924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgl01007]
    MGL_2924
Enzymes [BR:mgl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     MGL_2924
Amino acid related enzymes [BR:mgl01007]
 Aminotransferase (transaminase)
  Class III
   MGL_2924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 5854245
NCBI-ProteinID: XP_001729938
UniProt: A8Q6C8
AA seq 462 aa AA seqDB search
MSNFEQIQQKLSHLGQSMYSSATAMGHAAHSASTRQHHTSEELMKMESDFSAHNYHPLPV
VFDRAHGTRVWDPEGKEYLDFLSAYSAVNHGHCHPAVVGALIAQSQKLTLSSRAFYNSVF
AQFAKRVTELLKYDMVLPMNTGAEAVETAMKLARKWAYKKKGVPEGKARILSASGNFHGR
TIGVISMSTDPDSRNGFGPMLERVGPVVDNFTIRYNHAEDIEAVLAKYGNETAAVLLEPI
QGEAGIMVPDDTYFQKVHALCKQHNVLLICDEIQTGLGRTGRMLCCEHYGVRPDIITLGK
ALSAGVYPVSAVMADKDIMLCIEPGEHGSTYGGNPLGSAVSIAALDAIVKENMCERAEKL
GEEMRSSLKKINNPLLVEVRGKGLLNAIVIDETKSTKGRSAWDLCLLLKDKGLLAKPTHQ
NIIRLAPPLVISEEELRRGIKIIESALDELDKIDTIPGAEAH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatttcgaacaaattcaacagaagctgagccacttgggccagagcatgtattca
tctgctactgctatgggtcatgctgctcattcggcgtccacacgccaacaccacacgagt
gaagaactcatgaagatggaaagtgactttagtgctcataactaccatccactacccgtc
gtgtttgaccgcgcacacggaacgcgtgtttgggatcctgaaggtaaggaataccttgac
ttcttgtcagcctattctgcggtgaaccatggtcactgtcatccagctgttgtgggcgct
cttattgcccagtcacagaagctcacgctatcgtcgcgtgccttctataactctgtgttc
gctcagtttgcaaagcgtgtgacagagctcctgaagtacgacatggtgctccctatgaac
acaggtgctgaggctgtcgagacggctatgaagcttgctcgcaagtgggcttacaagaaa
aagggtgtgcctgagggcaaggcacgtattctgagcgcttcaggcaacttccatggccgc
acgatcggtgtcatcagtatgagcacagatcctgacagtcgcaatggtttcggtcctatg
ctagaacgtgtgggtccagtcgtggataactttacgatccgttacaaccacgctgaggat
attgaggctgtgctcgcaaagtatgggaacgaaacagctgccgtgcttctcgaaccaatc
cagggagaggctggtattatggtgccagacgacacatacttccagaaggtgcacgccctt
tgcaagcagcacaacgtgctccttatctgcgatgagattcagacaggcctcggccgtact
ggtcgtatgctctgttgtgagcactacggcgttcgtccggatatcatcacgctcggtaag
gcgctgagcgctggcgtttatccggtcagtgccgtgatggccgataaggatatcatgttg
tgcattgagcctggtgaacatggcagtacatacggtggaaatccgcttggttcagctgtg
tcgattgcggctctggatgccattgtcaaagagaacatgtgtgaacgtgctgaaaagctg
ggtgaagagatgcgctcttcgcttaagaagatcaacaatccactccttgttgaagtgcgt
ggcaagggtcttctcaatgccattgttattgatgaaacgaagagcacgaagggccgttcc
gcctgggacctgtgtctactcctcaaggacaagggtcttcttgctaaaccaacacaccag
aatattattcgccttgctcctccgcttgtcatttctgaagaagaactaagacgtggtatc
aagatcattgagtcggctctggatgagctggacaagattgacacgattcctggtgccgag
gcacattaa

DBGET integrated database retrieval system