KEGG   Malassezia globosa: MGL_3686Help
Entry
MGL_3686          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mgl  Malassezia globosa
Pathway
mgl00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MGL_3686
Enzymes [BR:mgl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MGL_3686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 5853525
NCBI-ProteinID: XP_001729219
UniProt: A8QAC7
AA seq 324 aa AA seqDB search
MKSAARPAQYMRQFSSGKTNANAPSSNLGLYLSAGGVAGLGAWYAMGGFNGDIRSKIQQV
NADSGDVALSGDEFRALKLKEVRPYNHDSSFYVFELPDNKRSGIFTASALVIRGAGEEPK
DKDGKPVIRPYTPVNPPTDKGELVLLIKHYPQGQMTQYLKSLKAGDEMHFKGPIPKHPYK
ANQFEEIGMVAGGSGITPMWQLIQEISSNPADKTKVTLLYGNKTEADILLREKFDEISKD
DRFKIVYFLDEASKNMKAEKGFITKEHIQKYLPGADKGEKAKIFVCGPPPMLKAVAGPKK
GFQQGELSGALADLGFKSEQVFKF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccgcggctcgtccagcccagtacatgcgtcagttctcatcgggcaagacgaat
gcgaacgccccatcgtcgaacttgggtctgtatctctcggccggtggtgtcgctggtctt
ggtgcatggtacgcgatgggcggctttaatggcgatatccgctcgaagatccagcaggtg
aacgccgactcgggtgacgtagctctctcgggtgatgagttccgtgcgttgaagctcaag
gaggtgcgcccatacaaccacgacagctcgttttacgtgttcgagctgccggacaacaag
cgttcgggtatctttactgcatctgcgcttgtgatccgtggcgctggtgaggagcccaag
gacaaggatggaaagcccgtcattcgtccctacacacccgtgaacccgccgaccgacaag
ggcgagcttgtgttgctcatcaaacactacccgcagggccaaatgacgcagtatctcaag
agcttgaaggccggtgatgaaatgcacttcaagggccctattcccaagcatccttacaag
gccaaccaatttgaggagatcggcatggttgccggtggttcgggtatcacccccatgtgg
cagctgattcaggaaatctcgtcgaacccagctgacaagacgaaggtcacgctcctttat
ggtaacaagacggaggctgacatccttctgcgcgagaagttcgatgagatcagcaaggac
gaccgcttcaagattgtctactttttggatgaagcatcgaagaacatgaaggcagaaaag
ggctttatcaccaaggagcacatccagaagtatcttcctggtgcggacaagggcgaaaag
gccaagatctttgtctgtggtcctccgcccatgctgaaggcggtggctggcccgaagaag
ggattccagcagggcgaactgtctggtgctcttgctgacttgggtttcaagtctgagcaa
gtgttcaaattctaa

DBGET integrated database retrieval system