KEGG   Malassezia globosa: MGL_3750
Entry
MGL_3750          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mgl  Malassezia globosa
Pathway
mgl00100  Steroid biosynthesis
mgl01100  Metabolic pathways
mgl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MGL_3750
Enzymes [BR:mgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MGL_3750
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 5853589
NCBI-ProteinID: XP_001729283
UniProt: A8QAJ1
AA seq 437 aa
MAMSSTNKKANRELLAPHSHELEFGGVFGALFVTVSVPLTMYYLTFGCNADMGCSAWLPL
SNASGFWSYAKKQFLDSFQDPVAWGLYYSWYLYCVVAWYVIPGDWVQGLPLRTGEKLSYK
INALKTGALALGIALAIIAIKGPASFTLLYDHFPGLLSAAFVNSIVQAIYVYVGSFRGDK
LLALGGNSGNVLFDWFIGRELNPRIGSFDIKTFNELRPGLLLWVLIDISCACHQWTTFGR
LSDSMALVTLFHAWYTIDSLIHESTIFSQMDITTDGFGFMLSVGDLAWLPFTYCLQARYL
AFHPVDLGLLGILAVLAVQFVGYYIFRTANVEKNEFRHGRNPKRLDFMTTSSGRKLLTSG
WWGRSRHPNYFGDWIMAWAWCLPCGFSTPIPYFYVIYFAVLLWHRQLRDDDACRKKYGND
WDVYCRLVPYRIIPYVY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcaatgagttcaacgaacaagaaagcgaacagggaattactagcgccccactcacat
gaacttgagtttggcggtgtgtttggcgctctatttgttacagtctccgtaccactgacc
atgtactacttaacgtttgggtgcaacgctgacatgggatgttctgcatggttgcctttg
tcgaatgcgtcagggttttggagctacgcgaaaaaacaatttttagatagcttccaggat
cctgttgcgtggggtttgtattactcctggtacctgtattgtgttgttgcgtggtatgtg
attcctggcgattgggttcagggcttgccgcttcgcacaggcgaaaagctctcatacaaa
atcaatgctttaaaaacgggtgctcttgctcttgggattgctttggccatcattgcgata
aagggcccggcttctttcaccctgctgtacgaccatttccctggactactcagtgcagcc
tttgtcaattcaattgtacaagcaatctatgtttatgtgggatcatttcgtggtgacaaa
ttgcttgctctgggcggaaatagtggaaatgtcctgtttgactggtttattggtcgtgaa
ctgaatccacgaatcggcagtttcgatatcaaaacattcaatgaactccgtcctggactt
ctgctctgggttttgattgacattagctgtgcttgtcaccaatggacaacatttggccgg
ctcagcgatagcatggcacttgtcactctgttccacgcctggtacaccatcgactcactt
attcatgagtctacgattttctcgcaaatggatatcacaaccgatggatttgggttcatg
ctcagcgtgggtgatctcgcatggctgccattcacatactgcttgcaagcacgttaccta
gctttccatccagtggatcttggcttgttgggcattttggcagttcttgcggtgcaattc
gttggatactacattttccgcacagcaaatgttgagaagaacgaatttcgccatggacgc
aatccgaaacgactcgactttatgacgacatcgtccggtcgcaagttgcttacatctggt
tggtggggcaggagccgacaccccaactatttcggtgattggattatggcctgggcatgg
tgcttgccatgtggcttcagcacgcctattccttacttctacgtgatatactttgccgtg
ctactatggcaccgccagttacgtgacgacgatgcatgtcggaagaagtatggcaatgac
tgggacgtttactgtcggctagtaccataccgcatcatcccatacgtgtactaa

DBGET integrated database retrieval system