KEGG   Magnetococcus marinus: Mmc1_0031Help
Entry
Mmc1_0031         CDS       T00427                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00780  Biotin metabolism
mgm01100  Metabolic pathways
Module
mgm_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mgm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Mmc1_0031
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgm01007]
    Mmc1_0031
Enzymes [BR:mgm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Mmc1_0031
Amino acid related enzymes [BR:mgm01007]
 Aminotransferase (transaminase)
  Class II
   Mmc1_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 ParB_C
Motif
Other DBs
NCBI-ProteinID: ABK42560
UniProt: A0L3L7
Position
33413..34600
Genome map
AA seq 395 aa AA seqDB search
MEQPHLAYRAFCQSREAAGQWRQLHAVQPLPRGRVLRDGVELINFSSNNYMGLADHPLLK
QRAMAWTEQWGTGAQASRLVCGDLEPFARIEARLVAGKGCEAALVLNAGYQANSSVIPAL
LDKRVLGGEPLVFSDRLNHASMHHGVQLAGVRQLRYRHGDLDHLERLLKRHAGEKVAKFI
LSETVFSMDGDRIDVGGLIALKQRYGAFLYLDEAHATGVLGPDGFGLAAAYPGQVDLVMG
TFSKGLGGFGAYVTCSHALRAYLINRAGGFIYSTALPPGVLGAMDAALELLPQMGEVRAR
VLAGAQRVRAALRAAGLDTGNSSTPIIPVMVGDEQRTLALSEGLRAEGLLGIAIRPPTVP
EGTSRLRLSLSAAHSDEDWSLLAAAVPRCLREING
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaccacacttagcataccgtgccttttgtcaaagcagagaggcggcgggtcaa
tggcgtcagctgcacgcggtgcagccgctgccccgtggccgggtgttgcgggatggggtg
gagctgatcaacttttcatccaacaactacatgggtttggcagatcaccccctgttgaag
cagcgggccatggcgtggaccgagcagtgggggacaggggcccaggcttcgcggctggtg
tgtggcgatctggagccctttgcacgcattgaagcccgcttggtggcaggtaaggggtgt
gaggctgcattggtgctcaatgcgggctatcaggccaacagttcggtgattccggcgctg
ttggataaacgggtgttggggggggagccactggttttttccgaccggttaaaccatgcc
tccatgcatcacggtgtccaattggcgggggtgcggcagctacgctatcggcatggcgat
ctggaccatctggagaggttgttaaagaggcacgcaggggaaaaggtcgctaaatttatc
ctctccgaaacggtgttcagtatggatggagaccggattgatgtgggggggttgatcgcg
ctcaaacagcgttatggggcctttttatatctggatgaagcccatgccaccggggtattg
ggacccgatggctttggtttggcggcggcctatccggggcaggtggatttggtgatgggg
acctttagcaaggggttggggggatttggcgcgtatgtgacctgtagccacgcgctgcgg
gcctacctgatcaatcgggcaggggggtttatctacagcacggctctcccccctggggtg
ttgggggcgatggatgccgcgttggagttgctgccccagatgggcgaggtacgggcgcgg
gtgttggcgggtgcccagcgggtacgagctgctttgcgcgcagcgggtttggatacaggt
aacagttcgacgccgattattccggtgatggtgggggatgagcagcgtactttggcgttg
agtgaggggttgcgggcagagggtctgttggggatcgccatccgtccaccgaccgtgccg
gagggaaccagtcgcttaaggctctctttgagtgccgcccacagcgatgaggattggagc
ctgctggccgctgcggtgccccgctgtttgcgagagatcaatggttga

DBGET integrated database retrieval system