KEGG   Magnetococcus marinus: Mmc1_0479Help
Entry
Mmc1_0479         CDS       T00427                                 

Definition
(GenBank) protein of unknown function DUF28
Organism
mgm  Magnetococcus marinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transcrip_reg
Motif
Other DBs
NCBI-ProteinID: ABK43004
UniProt: A0L4W1
Position
complement(577410..578162)
Genome map
AA seq 250 aa AA seqDB search
MAGHSKWANIKHRKGAQDAKRGKIFTRLIKEITVSARMGGGDAATNPRLRSAITAARAQN
LPKDTMDKAIKRGTGELEGVNYEEVRFEGYGPGGVAIIVDCLTDNNNRTVADVRHIFNKY
GGNMGTHGCVAFMFDKKGQIMFDAEGINEDAIIEAALEAGAEDVVHEGDSFEVLTDPNDF
SDVLEALATAGFATPSEAEVVMRPQNLQQLDEQQASTMLKLYEKLEENEDVQNIYANFDI
SDEIMETLSA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagggcatagtaaatgggccaatatcaaacaccgtaaaggcgcccaagacgctaag
cgcggtaaaatttttacccgcttgatcaaagagattaccgtttcagcccgcatgggcggc
ggggatgccgctaccaacccccggctgcgcagtgccatcacggcggcacgggcccaaaac
ctacccaaagataccatggacaaggccatcaagcggggcacaggtgagttagagggcgtc
aattatgaagaggtccgttttgaagggtacggcccaggcggtgttgccattattgtggat
tgtctaaccgataacaataaccgcacggttgccgatgtacgccacatcttcaataaatat
ggcggcaacatgggcacccatggctgtgtggcctttatgtttgataaaaaaggccaaatt
atgtttgatgccgagggtatcaacgaagatgccataatcgaagcggcgttagaagctgga
gctgaagatgtggtccatgaaggggatagttttgaggtcctcactgaccccaacgatttc
tcggatgtgttggaagccctagcgactgctggctttgccacccccagcgaggccgaagtg
gtcatgcgcccgcaaaacctccagcaattagatgagcaacaggccagcaccatgctgaaa
ctttatgaaaagttggaagagaatgaagatgtgcaaaacatctacgccaactttgacata
tccgatgagattatggagacactctccgcatga

DBGET integrated database retrieval system