KEGG   Magnetococcus marinus: Mmc1_3127Help
Entry
Mmc1_3127         CDS       T00427                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00860  Porphyrin and chlorophyll metabolism
mgm01100  Metabolic pathways
Module
mgm_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mgm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmc1_3127
Enzymes [BR:mgm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Mmc1_3127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ABK45617
UniProt: A0LCC4
Position
3900347..3901849
Genome map
AA seq 500 aa AA seqDB search
MALFFCLLKVAPMAHTLMIQGTTSDAGKSLMVTALCRLLHRQGVAVAPFKPQNMALNSAV
TSDGGEIGRAQALQARACGLEPHSDFNPILLKPNSDVGAQVIIQGRSVGNMKALAYHHFK
PQAMQYVLAAHQRLCQHYEVIVVEGAGSPAEINLRANDITNMGFATAVGCPVLLVGDIDR
GGLFAQLVGTMQLLAPPEQQLIQGFLVNKFRGDPALLAPGLEQLQQLTGKPTLGVLPYLH
GLHLEAEDSFFTTTPANPHAKLTVVVPRLPRLSNHTDLDPLRSHPDVALHLVEAGQAIPA
ADLILLPGSKSVRADLHWLRQQGWQAVLQRHLRYGGRLLGICGGFQMLGRQIHDPHGLEG
SPGSMDGLHLLEMQTTITPEKQLTRHTGNLLQGGAVEGYQIHMGRSSGPALAHPLLTLED
GSHEGASSQDGQIKGSYLHGLLDHPEALASLLNWAAPHHSLPVQDIRQLREASIDRLADA
FAEHVDMAFIHALLHRAQPN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggctctttttttctgtttgctgaaagtcgcacccatggcccatacccttatgattcaa
ggcaccacctccgatgccggtaaaagtttgatggtcaccgccctgtgccgcctgctgcac
cggcaaggggtggcggtggcaccctttaaaccccaaaacatggccctcaacagcgccgtc
accagcgacgggggcgaaattggccgcgcccaagcgctgcaagctcgcgcctgtggcttg
gaaccccatagcgattttaacccgattttgctcaaacccaactccgatgttggcgcccaa
gtgattatccagggccgctcggtaggcaatatgaaggcgctggcgtaccaccatttcaag
ccccaagccatgcagtatgtcttggcggcccatcaacgcttgtgtcaacactacgaggtc
attgtggtggagggcgcaggctcacctgccgagatcaacctacgcgccaatgacatcacc
aacatgggttttgccacggcggtgggctgcccggtgttgttggtgggggatattgaccgg
ggcggcctgtttgcgcagctggtgggtaccatgcagctcttagcccccccggaacagcag
ttgattcaagggtttttggtcaataaatttcgaggcgacccagccctgttggcaccgggg
ctggaacaacttcagcagctcaccggcaaacccaccctaggggtactaccctacctgcac
ggcctgcacctggaggccgaagactctttttttaccaccactcccgccaatccccacgcc
aagctgacggtggtggtcccccgcctgccgcgtctaagcaaccataccgatctggaccca
ctacgcagccaccccgacgtcgccctgcatctggtggaggccgggcaagcgatccccgct
gcggatttaatcctgctcccgggcagcaagagcgtgcgggccgatctgcactggctgcgc
caacagggctggcaagctgtactgcaacgccacctgcgctacggtgggcggttgttgggt
atctgcgggggttttcaaatgcttggccgtcagattcatgatccccacggcttggaaggc
agccccggctccatggatgggctccatttattagagatgcagaccaccatcaccccagaa
aaacagcttacccgccacaccggcaacctgttgcagggaggggccgtagagggctaccag
atccacatggggcgcagctcaggccccgccttggcccatccactgctcaccctggaggat
ggcagccacgagggagccagcagccaagatgggcagattaaggggagctatctgcatggt
ctgctggaccatcccgaagccctcgccagcctactaaactgggcagccccccaccacagc
ctgccggttcaggatattcgccagctccgcgaggccagcatcgaccggcttgccgatgct
tttgccgagcatgtggacatggccttcatccacgcgcttctgcaccgcgcccagcccaac
taa

DBGET integrated database retrieval system