KEGG   Magnetococcus marinus: Mmc1_3193Help
Entry
Mmc1_3193         CDS       T00427                                 

Definition
(GenBank) phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00630  Glyoxylate and dicarboxylate metabolism
mgm01100  Metabolic pathways
mgm01110  Biosynthesis of secondary metabolites
mgm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mmc1_3193
Enzymes [BR:mgm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     Mmc1_3193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ABK45683
UniProt: A0LCJ0
Position
3977646..3978398
Genome map
AA seq 250 aa AA seqDB search
MCSAKIIPFPASVVATHGRSQQQPPFPCSALLFDLDGTLVHTGPDLAGAMNHVLQSRGLA
TLDPIEVQHLVGNGARSLLARGFWGRGAEAPEGDSDFEAAVQQFLAYYAHHIADHSHPYP
GVMEGLQRLQEAGFFMAVVTNKPEFLAHKLLAELNMAHFFKVVVGGDTLPTRKPAPEMLY
HATVHMASAINEAVMVGDSDNDILAAQRANIPVIAVNYGYNQHDALAALHPDVLVDCFGA
IEGLVVREQA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagcgctaaaatcatcccttttcccgcatctgtcgtcgcgacccacggtcggtcg
caacaacaaccgcccttcccctgtagcgccctgctgtttgatttggatggcaccctggtg
cataccggtcccgatctggcgggagccatgaaccatgttctgcaaagccgggggctggcc
accttggaccccatagaggtccaacatctcgtcggcaatggtgctcgttcgctgctggcc
cggggcttttggggcaggggtgccgaagcccctgaaggggatagcgattttgaggccgcc
gtacagcaatttttagcctattatgcccaccatattgccgaccactcccacccctaccca
ggcgtgatggaggggttgcaacgcttgcaagaggcgggtttttttatggcggtagtgacc
aacaaaccggaatttctagcccacaagctgctagcagagctcaacatggcgcactttttt
aaagtggtggtggggggagatacactacccacccgcaagcccgcaccagagatgctctac
cacgccaccgtgcacatggccagcgccattaacgaggcggtgatggttggggattcggac
aacgatattttggccgctcagcgtgcaaacataccggtgattgcggtcaactatggttac
aaccagcatgatgccttagcggccctgcaccctgacgttttggtggattgttttggggct
attgaagggctggtggtacgcgagcaggcttag

DBGET integrated database retrieval system