KEGG   Magnetococcus marinus: Mmc1_3475Help
Entry
Mmc1_3475         CDS       T00427                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
mgm  Magnetococcus marinus
Pathway
mgm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmc1_3475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Paired_CXXCH_1 Cytochrome_C7
Motif
Other DBs
NCBI-ProteinID: ABK45960
UniProt: A0LDB7
Position
4337061..4337906
Genome map
AA seq 281 aa AA seqDB search
MKLDRDIFTVLLMAAVCVVILLIFGVVKRTTAPILNTTPDYANRGRELARQCLPCHDLTP
ARTLSEKGPPLWGIVDAMAGHTLYPYSEGYMELAKRCLVWNEANLDRFLTDPKRFMPGTR
KDYAPIADPEQRRLLIEFLTSLQDPQVTQPTLVAAENYAQVSATLNRMRGENAKRWRKAG
AKEAQKCTACHDLTQSAEIIVGPPLVDIVEREVGSSKGFCYSPGFRRWMENKENPKVWDE
VSLYRFLYAPQSHIPHTRMLFRGVRDDYKRAALIGHLKRLP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggatcgggatatttttacggtgctgctaatggcagcggtgtgtgtggttatt
ttactcatttttggcgtcgtaaaacgcaccaccgcgcccatactcaacaccaccccagac
tatgccaaccgggggcgtgagttggcccgccagtgcctgccttgccacgaccttacccct
gcccgcaccctcagcgaaaagggaccacccctgtggggaattgtggatgccatggccggt
cacaccctctacccctattccgaagggtatatggagttggccaagcgctgcttggtttgg
aacgaagccaaccttgaccgttttttgactgaccccaaacggtttatgcccggcacccgt
aaggattacgcacccatagccgatcctgaacagcgccgcttgcttattgaatttttaacc
agtttacaggacccccaagtcactcagcccacactggtggctgcggagaactatgctcaa
gtttcagcaaccctcaaccgcatgcgcggcgaaaacgctaaacgctggcgcaaagcgggg
gccaaagaggcccaaaaatgcaccgcttgtcacgatcttactcaatccgccgagatcatt
gtcggaccccccttagtggatatcgttgagcgggaagttggatcgagcaaaggcttttgc
tactcccccggttttcgccgctggatggagaataaagagaaccctaaggtgtgggatgag
gtgagcctgtatcgttttctctacgcgccccagtcccacataccccatactcgtatgctg
tttcgtggggtgcgggacgattataaacgggccgctttgatcggccatttaaaacgcttg
ccctaa

DBGET integrated database retrieval system