KEGG   Magnetococcus marinus: Mmc1_3557Help
Entry
Mmc1_3557         CDS       T00427                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00071  Fatty acid degradation
mgm00280  Valine, leucine and isoleucine degradation
mgm00310  Lysine degradation
mgm00362  Benzoate degradation
mgm00380  Tryptophan metabolism
mgm00620  Pyruvate metabolism
mgm00630  Glyoxylate and dicarboxylate metabolism
mgm00640  Propanoate metabolism
mgm00650  Butanoate metabolism
mgm00900  Terpenoid backbone biosynthesis
mgm01100  Metabolic pathways
mgm01110  Biosynthesis of secondary metabolites
mgm01120  Microbial metabolism in diverse environments
mgm01130  Biosynthesis of antibiotics
mgm01200  Carbon metabolism
mgm01212  Fatty acid metabolism
mgm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mmc1_3557
   00630 Glyoxylate and dicarboxylate metabolism
    Mmc1_3557
   00640 Propanoate metabolism
    Mmc1_3557
   00650 Butanoate metabolism
    Mmc1_3557
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mmc1_3557
   00072 Synthesis and degradation of ketone bodies
    Mmc1_3557
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmc1_3557
   00310 Lysine degradation
    Mmc1_3557
   00380 Tryptophan metabolism
    Mmc1_3557
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mmc1_3557
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmc1_3557
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mmc1_3557
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgm04147]
    Mmc1_3557
Enzymes [BR:mgm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mmc1_3557
Exosome [BR:mgm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmc1_3557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABK46042
UniProt: A0LDJ9
Position
complement(4466432..4467748)
Genome map
AA seq 438 aa AA seqDB search
MKPTEQNKMQPVYVIDGMRTPFLKTTGGPNPFSAADLGVQAGRALLMRQPFHADALDEVI
LGCVSPAADEVNIARVVALRLGCAVRTPAWTVQRNCGSGMQALDTAVRRIGRGEAALILA
GGVEAMSRAPLQFNSRYSRWMGQLVRSRTPLAKLRTLLGWRPGFMAPVITLLKGLTDPTT
GLSMGQTAENLAYRFGIERESMDAYAVRSHQRAAAAWEEGRMAAEVTPLYDAQGQIYAQD
DGIRPDSQEEKLAKLKPAFEPPHGRITAGNSAQITDGAALLLLASEAMVEHYQLTPLGKL
YPAQWVGLAPEQMGLGPAHAIAPLLQELEWDMSAIDLWEINEAFAAQVMACSEALADGDY
CAQMLGVDHALGHMNPARLNVDGGAVSLGHPVGASGARIVLHLLHALGQRHLKRGIAALC
IGGGQGGAMLVEGMGGPS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaccgagcaaaacaagatgcaaccggtctatgtgattgatgggatgcgtacc
ccttttctcaaaaccacaggggggccaaatcctttcagtgcggcggatttaggggtgcag
gcggggcgtgcgttgttgatgcggcaaccctttcatgcggatgccttggatgaggtgatt
ttgggctgtgtctccccggcggccgatgaggtgaatattgcgcgggtggtagccttacgg
ctggggtgtgcggtgcgcaccccagcgtggacggtgcagcgcaactgtggttcgggcatg
caggcgttggatacggcggtgcggcgcattggccggggtgaggcggcgttgattttggcc
ggtggggtggaggcaatgtcccgtgcgccgttgcagtttaacagccgttatagccgttgg
atggggcaactggtgcgcagtcgtacaccgttggccaagttgcgtaccctgctggggtgg
cgtcccggttttatggcaccggttatcacgctattgaaggggttgaccgatcccaccacc
ggcctctccatggggcagacggcggagaatctggcctaccgctttggtattgagcgggag
agcatggatgcctatgcggtgcgcagtcatcaacgggcggcggcggcgtgggaggagggg
cgcatggccgccgaggtgacgccgctctacgatgcgcaagggcagatctacgcccaggat
gatggcatacggcccgatagccaggaggagaagctggccaagcttaaaccggcttttgaa
ccgccccatggccgcatcacagcgggcaacagtgcccagattaccgatggcgctgcgctg
ctgctgttggccagtgaggccatggttgaacactaccagcttaccccgttgggcaagctc
tatccggcccagtgggtggggttggcaccggagcagatggggttgggaccagcccacgcc
atcgcgccattattgcaagagctggaatgggatatgagtgccattgatctgtgggagatc
aacgaagcctttgctgcccaggtgatggcctgtagtgaagcactggccgatggggactat
tgtgcccagatgttgggggtggatcatgctctggggcatatgaatcctgcccgtcttaat
gtggacggtggcgcggtgagtttgggccatccggtgggggccagtggtgcccgcattgta
ttgcatctgctgcacgccttggggcagcgccatctgaaacgtggtattgccgccctctgt
atcggtggggggcagggtggcgcgatgctggtggaaggcatgggaggtccgtcatga

DBGET integrated database retrieval system