KEGG   Mycoplasma gallisepticum NC06_2006.080-5-2P: HFMG06NCA_3594Help
Entry
HFMG06NCA_3594    CDS       T02200                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltransferase (E2) component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgn  Mycoplasma gallisepticum NC06_2006.080-5-2P
Pathway
mgn00010  Glycolysis / Gluconeogenesis
mgn00020  Citrate cycle (TCA cycle)
mgn00620  Pyruvate metabolism
mgn01100  Metabolic pathways
mgn01110  Biosynthesis of secondary metabolites
mgn01120  Microbial metabolism in diverse environments
mgn01130  Biosynthesis of antibiotics
mgn01200  Carbon metabolism
Module
mgn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG06NCA_3594 (aceF)
   00020 Citrate cycle (TCA cycle)
    HFMG06NCA_3594 (aceF)
   00620 Pyruvate metabolism
    HFMG06NCA_3594 (aceF)
Enzymes [BR:mgn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HFMG06NCA_3594 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 DUF2118 DUF1999 E3_binding
Motif
Other DBs
NCBI-ProteinID: AFP79846
Position
complement(613831..615159)
Genome map
AA seq 442 aa AA seqDB search
MFEYKFTDVGEGLHEGVVAQIYVKVGDTIKEGDPMFSVETDKVTTDLPAPEGGKVTAILA
SVGQTVHVGEVMLVLNGDGSSAPAAAPAPAAAPATPAFVAPTPAVTPAPAPTEAAPSGGG
ASVVGEVKVSNTLFGLFGDQRAASTLTPAPATAFAPTPAPVATPLAQAVASDLNVNLHNV
TPANGAKVFSSDVFASAQQSSLAASVAANDNETYKEITSIRKAIAKAMTTAHEEIPATVL
TFNFDVTKLVSYRKQVKDAVLASYNVKLSFLPFLLKAITKAVVAHPVFNSHYDKASNRLV
LKKKINLGIAVDTADGLMVPNIKSAQDKSVIELAREVNNLAEKARSKKIGLADLADGTIS
VTNFGSIGALFGTPIIKFPEVAIIATGTIEEKLARTPENQIVIKQIMPITIAADHRWIDG
ADIGRFAKTLKEIVENLDGLLI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatataaatttacagacgttggtgaagggctacacgaaggtgttgttgctcaa
atctatgttaaagtaggtgacacaattaaagaaggcgacccaatgttttcagtcgaaact
gataaggttacaactgacttaccagctcctgaaggtggaaaagttactgcgatccttgca
tcagtaggacaaactgttcacgttggtgaagtaatgcttgttttaaacggtgatggttca
tcagctccagctgctgcgccagctccagctgctgcgcctgctactccagcttttgtagct
cctactccagctgttacaccagctcctgctcctactgaagctgctcctagtggtggtggt
gcttcagttgtaggtgaagttaaagtttcaaacactttatttggattatttggtgatcaa
cgcgctgcaagcactctaacaccagctcctgctacagcttttgcgccaactccagctcca
gttgcgactcctttagctcaagctgttgctagtgatttaaatgtaaatttacacaacgta
acacctgctaacggtgctaaagtattctcaagcgatgtatttgcatcagctcaacaaagt
tcactagctgctagtgtagctgcaaacgataacgaaacttacaaagaaattacatcaatt
agaaaagcaattgctaaagcaatgactactgctcacgaagaaattccagcaactgtttta
acattcaactttgatgtaactaaattagtatcataccgtaagcaagttaaggatgctgta
ttagcaagttacaatgttaaattatcattcttaccattcttattaaaagcaattactaaa
gctgtagttgctcacccagttttcaactctcactacgacaaagctagcaaccgcttagta
ttaaagaaaaagattaacttaggtattgctgttgatactgctgatggtttaatggttcct
aacattaaatcagctcaagacaaatcagtgattgaacttgctagagaagtaaacaattta
gctgaaaaagctcgctctaagaagatcggtttagctgatttagctgatggtacaatcagt
gtaactaactttggttcaatcggggctttatttggtacaccaattattaaattcccagaa
gttgcaattattgctactggtacaatagaagaaaaattagcaagaactcctgaaaaccaa
atcgtaattaagcaaattatgccaattacaattgcagctgaccacagatgaatcgatggt
gctgatatcggtagatttgctaaaacattaaaagaaatcgttgaaaatcttgacggttta
ctaatttaa

DBGET integrated database retrieval system