KEGG   Mycoplasma gallisepticum NC96_1596-4-2P: HFMG96NCA_0663Help
Entry
HFMG96NCA_0663    CDS       T02328                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mgnc  Mycoplasma gallisepticum NC96_1596-4-2P
Pathway
mgnc00900  Terpenoid backbone biosynthesis
mgnc01100  Metabolic pathways
mgnc01110  Biosynthesis of secondary metabolites
mgnc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mgnc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HFMG96NCA_0663 (dxr)
Enzymes [BR:mgnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HFMG96NCA_0663 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Epimerase DapB_N
Motif
Other DBs
NCBI-ProteinID: AFP77251
Position
108591..109697
Genome map
AA seq 368 aa AA seqDB search
MKILVLGATGSIGKQTIDVICQLKYQLVGFSYYQNHNEANNILKQLNPNYVLCHSDPKYN
KNVKSDLIELIDKSKPKVIINAINGYHGIEASLIALSKKKDLLLANKESLVIAGSQLEAI
RKDTKTTIYPIDSEHSALYDLLKDKKKNQIKQLMITASGAGYFNKDISELRKLTYNDLLN
HPNWKMGAEISINSATFVNKVYEIVEAYHLFKIKDIIPVVERSSTIHAGVIYQDNSIHFH
ATTNDMRWAIQSALTKFDNRTNVVQSLDLYQKTIQFEKIDFEQYPIFKIAYDILKNPYTT
RGAVLTCINQHVVKLFQKQKINFLQITELISNFYWNYQHKKIDDIWQINDLIFKIKAAIS
SKYAYLDK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttagtgcttggagcaactggatcaattggcaagcaaacaattgatgtgatc
tgccaactaaagtaccaattagttggtttttcttattatcaaaaccacaatgaagccaat
aatattcttaaacaattaaatcccaactatgttttatgtcatagtgatcccaaatacaat
aagaatgttaagagtgatttaattgagctaattgataaaagtaagcctaaagttattatt
aatgcaattaatggttatcatggaattgaagcttcattaattgcgcttagtaagaaaaaa
gatctcttgttagctaataaagaatcgttagtgattgctggatcacaactagaagcaatt
agaaaagatacgaaaacaacgatctatccgatcgattcagagcacagtgcactgtatgat
ttattaaaagataagaaaaaaaatcagattaaacaattaatgatcacagcatctggagcg
ggatattttaataaagatataagtgagcttagaaagctcacttataatgatctcttaaat
catcctaattggaagatgggtgcagagatctcgattaattcagctacgttcgtaaacaaa
gtttatgagattgttgaagcttatcatctttttaaaataaaagatattatccccgtggtg
gaaagaagttcgacaatccatgctggggtgatctatcaagataattcgattcattttcat
gcgacgaccaacgacatgcgttgagcgatccagtcagcactaaccaaatttgataataga
actaacgttgttcaatcgttagatctttatcaaaaaacgattcaatttgaaaaaattgat
tttgaacaatatccgatatttaaaattgcttatgatatattaaaaaatccctacacgaca
agaggagctgtactgacttgtattaatcaacatgtcgttaagttgtttcaaaagcaaaag
atcaattttttacagattactgaactgattagtaatttttattgaaactatcaacataaa
aaaattgatgacatttggcaaataaacgatttaatatttaaaattaaagcagcgatctca
agcaaatatgcttatttagataaataa

DBGET integrated database retrieval system